RPAP2
Species: Human
Alias: NP_079089.2, RPAP2
External Links: COSMIC , Entrez Gene
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: RTR1
Family: RTR1
Subfamily: RTR1
Protein domain

Protein domains of RPAP2.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase RPAP2.AA RPAP2_Rtr1 78-153 44 6.3e-40 140.61 Pfam 1-88 (88) Show / Hide
Range on Protein: 78-153
Range on HMM: 1-88/88
Sequence Identity: 44% (39 aa)

CGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-KQKYKISTK-TNKVYDITERK----------SFCSNFCYQASKFFEAQIPK
..|..||.|| |||.||.|.|.||||||.. .. .| ||.|.|..| .||||||..||          .|||..||..|.....|...
MLRYFTPSHYDDVVEERNINKKCGYPLCPNPPKNIPGKQRYRIDWKGENKVYDIENRKYEYWPNTMLSMFCSKDCYRCSQYYRVQLSE

Phosphatase RPAP2.AA Family.RTR1.PD 78-152 65 1.3e-37 115.8 In-house 1-75 (76) Show / Hide
Range on Protein: 78-152
Range on HMM: 1-75/76
Sequence Identity: 65% (49 aa)

CGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEAQIP
..|..||.||||||.|||| |.||||||.|.|. ..|||||||.|..|||||||||.|||..||.||||...|..
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls

Phosphatase RPAP2.AA Group.RTR1.PD 78-152 65 1.3e-37 115.8 In-house 1-75 (76) Show / Hide
Range on Protein: 78-152
Range on HMM: 1-75/76
Sequence Identity: 65% (49 aa)

CGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEAQIP
..|..||.||||||.|||| |.||||||.|.|. ..|||||||.|..|||||||||.|||..||.||||...|..
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls

Phosphatase RPAP2.AA Subfamily.RTR1.PD 78-152 65 1.3e-37 115.8 In-house 1-75 (76) Show / Hide
Range on Protein: 78-152
Range on HMM: 1-75/76
Sequence Identity: 65% (49 aa)

CGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEAQIP
..|..||.||||||.|||| |.||||||.|.|. ..|||||||.|..|||||||||.|||..||.||||...|..
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls

Sequence
Name Sequence Type Origin Length Description Download
RPAP2.AA Protein None 612 None Fasta, JSON
RPAP2.NA RNA None 1836 None Fasta, JSON
RPAP2.AA.PD_78-153 Protein Phosphatase Domain None 76 None Fasta, JSON