aque_CDC14
Species: A.queenslandica
Alias: aque_CDC14
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: DSP
Subfamily: CDC14
Protein domain

Protein domains of aque_CDC14.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase aque_CDC14.AA Subfamily.CDC14.PD 72-254 49 4.8e-61 194.2 In-house 7-188 (258) Show / Hide
Range on Protein: 72-254
Range on HMM: 7-188/258
Sequence Identity: 49% (90 aa)

KKIIHYTSYDSRRRANAAYLIGCYVIIYHKKTPDEAFRPLAAAqNPPFQPFRDAAMGPCTYNLTLQHCFQAVHKALQFGFLDFSQFNVEEYEHYERVENG
..|   |. | . |.||| ||| ...   . | ..|   | .| .||| |||||.. |  |.| ...   ....||  ||.|   |... |.|.||||||
qriyfctgtdmqvrsnaaaliglfavwclnmtdeqaiacldta-kppfapfrdasyapvlyklhvryvisgayqallngfidvhtfdldtydhferveng

DLNWIVPGKFLAFAGPHNKSRIEQGYPLHAPEFYFPYFRHYKVSTIVRLNKRLYDAQRFIDGGFDHKDLFFVDGSTPSDTIVK
|.  |.| ||.|.|||||||..|.||.|.||| .. |||. .|.|||||||.||||..| | ||.|.||||.||..|||.|.|
dfttiipnkfialagphnkskvedGytllaPeklleyfrknnvttivrLnkklYdakkftdaGfahlDlffiDGtvPsdailk

Phosphatase aque_CDC14.AA Family.DSP.PD 73-249 27 4.1e-23 69.9 In-house 8-166 (387) Show / Hide
Range on Protein: 73-249
Range on HMM: 8-166/387
Sequence Identity: 27% (49 aa)

KIIHYTSYDSRRRANAAYLIGCYVIIYHKKTPDEAFRPLAAAQnPPFQPFRDAAMGPCTYNLTLQHCFQAVHKALQFGFLDFSQFNVEEYEHYERVENGD
.|   |  | . |.||| ||| . .   ..| ..|   |. .. |.| |||||...| ...|  .   .    |.. ||.|...|....|.|.||||||.
riyfctGtdmqvrsnaaaliGlfavwclnmtdeqaiacldtvk-pkfapfrdasyapvlaklhvryvisgakqaelngfidvhtfdldtydhfervengk

LNWIVPgkflafagphnksRIEQGYPLHApeFYFPYFRHYKVSTIVRLNkrlYDAQRFID-GGFDHKDLFFVDGSTPS
 . | |             ..  |..|.|    .. .....|. ||.|.   .| ..|   .|. . .... |...|.
pseilp-------------hlylgsllaa--knlewlkelgvtkivnlt---ddkpqftkelgikylripidDhnapp

Phosphatase aque_CDC14.AA Subfamily.PRL.PD 205-254 28 3.9e-08 20.8 In-house 17-66 (140) Show / Hide
Range on Protein: 205-254
Range on HMM: 17-66/140
Sequence Identity: 28% (14 aa)

YFPYFRHYKVSTIVRLNKRLYDAQRFIDGGFDHKDLFFVDGSTPSDTIVK
.   .....|...||  .  |||... . | . .|| | ||..|.. .|.
fieelkkenvkevvrvcepsydaeklkeegievldlafddGavPpkevvd

Sequence
Name Sequence Type Origin Length Description Download
aque_CDC14.AA Protein None 254 None Fasta, JSON
aque_CDC14.NA RNA None 762 None Fasta, JSON