g23277.t1
Species: A.queenslandica
Alias: g23277.t1
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: OCA
Subfamily: OCA
Protein domain

Protein domains of g23277.t1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase g23277.t1.AA Family.OCA.PD 2-32 54 6e-08 23.3 In-house 84-113 (165) Show / Hide
Range on Protein: 2-32
Range on HMM: 84-113/165
Sequence Identity: 54% (17 aa)

LKLLLShEENLPVLIHCVYGKDRTGVLVALI
||.||  ..| ||||||  ||.|||..|. .
lkilld-vdnypvlihcnkGkhrtglvvgcl

Phosphatase g23277.t1.AA Subfamily.OCA.PD 2-32 54 6e-08 23.3 In-house 84-113 (165) Show / Hide
Range on Protein: 2-32
Range on HMM: 84-113/165
Sequence Identity: 54% (17 aa)

LKLLLShEENLPVLIHCVYGKDRTGVLVALI
||.||  ..| ||||||  ||.|||..|. .
lkilld-vdnypvlihcnkGkhrtglvvgcl

Phosphatase g23277.t1.AA Subfamily.N14.PD 7-37 40 2.4e-06 17.7 In-house 203-235 (275) Show / Hide
Range on Protein: 7-37
Range on HMM: 203-235/275
Sequence Identity: 40% (13 aa)

SHEENLPVLIHCVYGKDRTGVLVA--LILDCIG
..|.. |||.||  |  |||||.   |.. .. 
vkeskPPvlvhCsaGvGrtGvlilsdlliatle

Phosphatase g23277.t1.AA Subfamily.R_Ecdysozoa.PD 11-61 31 3.2e-06 17.3 In-house 201-250 (269) Show / Hide
Range on Protein: 11-61
Range on HMM: 201-250/269
Sequence Identity: 31% (16 aa)

NLPVLIHCVYGKDRTGVLVALILDCIGVESETIAmDYASSEDGLVSMRNEM
. |...||  | .|.|..||| |    .. |  . |      .| | || .
rsPivvhCsaGvgrsgifvaldlllqqlkaedkv-difetvkkLrsqrnll

Phosphatase g23277.t1.AA Subfamily.R_Nematode_3.PD 11-59 26 6.7e-06 16.4 In-house 197-246 (267) Show / Hide
Range on Protein: 11-59
Range on HMM: 197-246/267
Sequence Identity: 26% (13 aa)

N-LPVLIHCVYGKDRTGVLVALILDCIGVESETIAMDYASSEDGLVSMRN
.  ||..||. |  |...|.| .| .  .  .. ..|..|  . | ..| 
sktpvvVHCsdGisRsatlaaielgyqliikskgkldllslikelrkqRa

Phosphatase g23277.t1.AA Family.DSP.PD 13-32 52 7.1e-06 16.3 In-house 187-206 (387) Show / Hide
Range on Protein: 13-32
Range on HMM: 187-206/387
Sequence Identity: 52% (9 aa)

PVLIHCVYGKDRTGVLVALI
||.||  || |.|.|..   
vVlVHCkaGkgRsgtliiaY

Phosphatase g23277.t1.AA Subfamily.N3.PD 9-33 45 8.8e-06 15.9 In-house 191-215 (261) Show / Hide
Range on Protein: 9-33
Range on HMM: 191-215/261
Sequence Identity: 45% (11 aa)

EENLPVLIHCVYGKDRTGVLVALIL
.. ||..||  | .|||||..| . 
gkeePvvvhCsaGigrtGvlillet

Sequence
Name Sequence Type Origin Length Description Download
g23277.t1.AA Protein None 120 None Fasta, JSON
g23277.t1.NA RNA None 360 None Fasta, JSON