• Phosphatome.Net

Gene Aque_c110

Aque_c110
Species: A.queenslandica
Alias: Aque_c110
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: HAD
Family: FCP
Subfamily: DULLARD
Protein domain

Protein domains of Aque_c110.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase Aque_c110.AA Group.HAD.PD 1-37 22 1.1e-06 17.6 In-house 108-152 (190) Show / Hide 
Range on Protein: 1-37
Range on HMM: 108-152/190
Sequence Identity: 22% (10 aa)

KDCTMDMNGYTK------NLSMISEDLSNIFILDNSPSAYRG--N
..|..  . . .      .|...  ||....|.||.||..    |
dacvylkgpgalllatnrdlgalvrdlekvviidnkpsvfafecn
Phosphatase Aque_c110.AA Subfamily.DULLARD.PD 2-38 62 2e-16 48.8 In-house 101-137 (172) Show / Hide 
Range on Protein: 2-38
Range on HMM: 101-137/172
Sequence Identity: 62% (23 aa)

DCTMDMNGYTKNLSMISEDLSNIFILDNSPSAYRGNP
.||.....|||.||..|||||...||||||.||| ||
hCtlesgkytkdlslvsedlssviilDnspvayrknp
Phosphatase Aque_c110.AA Family.FCP.PD 2-38 40 2.5e-10 29.3 In-house 93-129 (164) Show / Hide 
Range on Protein: 2-38
Range on HMM: 93-129/164
Sequence Identity: 40% (15 aa)

DCTMDMNGYTKNLSMISEDLSNIFILDNSPSAYRGNP
.|..  . |.|.||....|||...|.|.||..|. ||
ecvlvkgnyvkdLsklgrdlskviiiDdspdsyklnp
Phosphatase Aque_c110.AA Subfamily.SCP.PD 2-35 40 1e-09 27.0 In-house 92-125 (163) Show / Hide 
Range on Protein: 2-35
Range on HMM: 92-125/163
Sequence Identity: 40% (13 aa)

DCTMDMNGYTKNLSMISEDLSNIFILDNSPSAYR
| .  . | |.|| .  ||... |.||||..|  
scvfhkgnyvkdlsrlGrdlkkvvivdnspasyi
Phosphatase Aque_c110.AA Subfamily.HSPC129.PD 3-34 43 5.2e-07 18.3 In-house 94-125 (164) Show / Hide 
Range on Protein: 3-34
Range on HMM: 94-125/164
Sequence Identity: 43% (14 aa)

CTMDMNGYTKNLSMISEDLSNIFILDNSPSAY
|    . | |.||..  |||.  |.|||| |.
cvcvdgnyikdlsilGrdlsktiivdnspqaf
Sequence
Name Sequence Type Origin Length Description Download
Aque_c110.AA Protein None 38 None Fasta, JSON
Aque_c110.NA RNA None 114 None Fasta, JSON
Aque_c110.AA.PD_2-38 Protein Phosphatase Domain None 37 None Fasta, JSON