• Phosphatome.Net

Gene g7211.t1

g7211.t1
Species: A.queenslandica
Alias: g7211.t1
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: PPP
Family: PPP
Subfamily: PPP_Unclassified
Protein domain

Protein domains of g7211.t1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase g7211.t1.AA Metallophos 2-162 17 5.6e-13 49.71 Pfam 17-124 (124) Show / Hide 
Range on Protein: 2-162
Range on HMM: 17-124/124
Sequence Identity: 17% (29 aa)

NKLDTIGFDNKKDLLISVGDLVDRGAENVE------CLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELP
|.|  |. . | |..| .||.|||| .  |      |...    .. .|||||. | ..    .                         ..  ...... 
NRLFEII-E-KPDFVIFTGDYVDRGPWSDECIWLLFCYKMNYPGPVYWVRGNHDYMHGNDFYGFY-E----------------------NDW-MWWWWF-

LIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAV
.  ..   |.|....|.                                  .  |.|  |.|||   
WMPLA-LDDWKILCMHGPP------------------------------FCK-NGVDYVIRGHTHVP
Phosphatase g7211.t1.AA Family.PPP.PD 4-54 32 3.9e-10 27.9 In-house 114-170 (349) Show / Hide 
Range on Protein: 4-54
Range on HMM: 114-170/349
Sequence Identity: 32% (18 aa)

LDTIGFDNKKDLLISVGDLVDRGAENVECLELIT-----FP-WFRAVRGNHEQMMID
.|. |.....  .. .|| |||| ..||.. |..     .|  |  .|||||. .. 
fdinglppaenkylFlGDyVDRGkfsvEvilllfalkllypsrffllRGnhEsrsvn
Phosphatase g7211.t1.AA Group.PPP.PD 4-54 32 3.9e-10 27.9 In-house 114-170 (349) Show / Hide 
Range on Protein: 4-54
Range on HMM: 114-170/349
Sequence Identity: 32% (18 aa)

LDTIGFDNKKDLLISVGDLVDRGAENVECLELIT-----FP-WFRAVRGNHEQMMID
.|. |.....  .. .|| |||| ..||.. |..     .|  |  .|||||. .. 
fdinglppaenkylFlGDyVDRGkfsvEvilllfalkllypsrffllRGnhEsrsvn
Sequence
Name Sequence Type Origin Length Description Download
g7211.t1.AA Protein None 193 None Fasta, JSON
g7211.t1.NA RNA None 579 None Fasta, JSON
g7211.t1.AA.PD_2-162 Protein Phosphatase Domain None 161 None Fasta, JSON