• Phosphatome.Net

Gene DDB_G0285459

DDB_G0285459
Species: D.discoideum
Alias: DDB_G0285459
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: DSP
Subfamily: DSP_Unclassified
Protein domain

Protein domains of DDB_G0285459.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase DDB_G0285459.AA Subfamily.Laforin.PD 155-208 30 6.2e-06 16.4 In-house 88-137 (165) Show / Hide 
Range on Protein: 155-208
Range on HMM: 88-137/165
Sequence Identity: 30% (16 aa)

DKLPQRMRDYHNILlterELPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKA
..||| .   | .|    |   ..||||..|  |.  ..  ...   ||.| | 
enlpqavyllhall----ekghivyvhcnagvgrstaivcgflqyvlgwslakv
Phosphatase DDB_G0285459.AA Family.DSP.PD 177-211 42 4.3e-09 26.6 In-house 187-221 (387) Show / Hide 
Range on Protein: 177-211
Range on HMM: 187-221/387
Sequence Identity: 42% (15 aa)

VLYVHCECGCDRTGEVMASYVMKFKGWDLPKALEW
| .|||  |  |.| . . | ||..|. |..||.|
vVlVHCkaGkgRsgtliiaYlmksegltleealdw
Phosphatase DDB_G0285459.AA Subfamily.PTPMT1.PD 170-210 29 3.8e-07 20.5 In-house 81-121 (146) Show / Hide 
Range on Protein: 170-210
Range on HMM: 81-121/146
Sequence Identity: 29% (12 aa)

TERELPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKALE
.....   .||||  |  | . ..|.|.|| | .   .| .
kvaskgssvYvHCkAGrtRsatlvacylmkkkklspeeavk
Phosphatase DDB_G0285459.AA Subfamily.RNGTT.PD 174-211 31 2.1e-06 18.0 In-house 78-115 (140) Show / Hide 
Range on Protein: 174-211
Range on HMM: 78-115/140
Sequence Identity: 31% (11 aa)

LPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKALEW
.|. |||  | .||| ....|... . |.. .|..   
PdevigvhCthGfnrtGflivayLvekedwsveaaval
Phosphatase DDB_G0285459.AA Subfamily.DSP12.PD 178-210 36 2.9e-06 17.9 In-house 84-116 (143) Show / Hide 
Range on Protein: 178-210
Range on HMM: 84-116/143
Sequence Identity: 36% (12 aa)

LYVHCECGCDRTGEVMASYVMKFKGWDLPKALE
..|||. |  |   ... |.|| ....| |||.
vlvHClagvSRSvtiviAYlmkkeklslekAlk
Phosphatase DDB_G0285459.AA Subfamily.Slingshot.PD 161-211 26 3.1e-06 17.5 In-house 65-115 (139) Show / Hide 
Range on Protein: 161-211
Range on HMM: 65-115/139
Sequence Identity: 26% (13 aa)

MRDYHNILLTERELPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKALEW
. .. . . .|  . . |||  |  |.  .. .| ||  ...| .|||.  
wnetykfiekakekgskvlvhckmGvsrsastviayamkeyelsleealey
Phosphatase DDB_G0285459.AA Subfamily.DSP23.PD 173-203 36 4.4e-06 17.3 In-house 64-94 (128) Show / Hide 
Range on Protein: 173-203
Range on HMM: 64-94/128
Sequence Identity: 36% (11 aa)

ELPTVLYVHCECGCDRTGEVMASYVMKFKGW
.    . |||  |. ||| ..| |..| .| 
kkeeavgvhcalGlGrtGtllacylvkeegl
Phosphatase DDB_G0285459.AA Subfamily.DSP10.PD 168-208 31 7.1e-06 16.4 In-house 74-114 (141) Show / Hide 
Range on Protein: 168-208
Range on HMM: 74-114/141
Sequence Identity: 31% (13 aa)

LLTERELPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKA
.   |.  ... |||. |  |.  |. .||||...  | .|
ieearkrgsrvlvhchaGisrsatvviayvmkhlslslsea
Phosphatase DDB_G0285459.AA Subfamily.CDC14.PD 178-211 29 8e-06 16.1 In-house 201-234 (258) Show / Hide 
Range on Protein: 178-211
Range on HMM: 201-234/258
Sequence Identity: 29% (10 aa)

LYVHCECGCDRTGEVMASYVMKFKGWDLPKALEW
. |||  |  ||| ....|..|  .   . .. |
iavhCkaGLGrtgtligcylikhyrftaaetiaw
Phosphatase DDB_G0285459.AA Subfamily.DSP19.PD 171-209 36 9.9e-06 15.9 In-house 75-113 (139) Show / Hide 
Range on Protein: 171-209
Range on HMM: 75-113/139
Sequence Identity: 36% (14 aa)

ERELPTVLYVHCECGCDRTGEVMASYVMKFKGWDLPKAL
|.   ...|||. |  |.  |. .|.|| .  .| ||| 
arskdgrvlvHCnAGvSRsasvviaylmkdeelslekal
Sequence
Name Sequence Type Origin Length Description Download
DDB_G0285459.AA Protein None 261 None Fasta, JSON
DDB_G0285459.NA RNA None 786 None Fasta, JSON