DDB_G0291338
Species: D.discoideum
Alias: DDB_G0291338
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: HAD
Family: NagD
Subfamily: PGP
Protein domain

Protein domains of DDB_G0291338.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
DUF2010 DDB_G0291338.AA DUF2010 7-167 28 2.2e-89 297.27 Pfam 1-193 (193) Show / Hide
Range on Protein: 7-167
Range on HMM: 1-193/193
Sequence Identity: 28% (55 aa)

IEA-IKCLKHVFLNRSLIIPHLEVKDIRNINFQS--------LYDRGFKGVLFDKDNTLTEPYKNEIYNPYKESL-NKCL---------EIFGNDNVVII
|.| ........ |.||.||||.|..........        |.....|.| .||||....|....|..||.|.. ..|.         ....|....|.
ISAFTLNVCRLMYNPSLCIPHLTVPTFNHLPWPINPFLQQKGLKKPHIKAVVLDKDNCFCYPHDDKIWPPYQEKWSERCRNSHTSPFNQQVYPNKRILIV

SNSAGSSDDAPNFEKANQIEKSLG--IKVLKHN---TKKP--DGIDSVKNHFKTD-----PKNLIMIGDRYLTDILFGNLYG-MLTIYTHPIT
|||||..|..|..|.|...|...|  |.||.|.   ||||  .........||..     |......|||..||.|..|..| ..........
SNSAGTHDYDPDYEQAEALERNTGLRIPVLRHHEGSTKKPAAGCHEEIMEYFKCNKVVTRPHEIAVVGDRLFTDMLMANMMGSWGVWCRDGVR

Phosphatase DDB_G0291338.AA Family.NagD.PD 125-157 39 1.9e-08 21.5 In-house 207-239 (239) Show / Hide
Range on Protein: 125-157
Range on HMM: 207-239/239
Sequence Identity: 39% (13 aa)

IDSVKNHFKTDPKNLIMIGDRYLTDILFGNLYG
......... ||.. .|||||  |||||.. .|
fealleklgvdpertvmiGDrlntDilfaqkcG

Phosphatase DDB_G0291338.AA Subfamily.PGP.PD 125-157 45 7e-08 19.4 In-house 211-243 (243) Show / Hide
Range on Protein: 125-157
Range on HMM: 211-243/243
Sequence Identity: 45% (15 aa)

IDSVKNHFKTDPKNLIMIGDRYLTDILFGNLYG
.|......| ||.  .|.|||  ||||||. .|
ldallekakidpertlmvGDrldtDilfgkncG

Sequence
Name Sequence Type Origin Length Description Download
DDB_G0291338.AA Protein None 218 None Fasta, JSON
DDB_G0291338.NA RNA None 657 None Fasta, JSON