janB
Species: D.melanogaster
Alias: janB
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: PHP
Family: PHP
Subfamily: PHP
Protein domain

Protein domains of janB.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Ocnus janB.AA Ocnus 28-136 40 1e-51 182.95 Pfam 1-118 (118) Show / Hide
Range on Protein: 28-136
Range on HMM: 1-118/118
Sequence Identity: 40% (48 aa)

LVGVPRVKIT-KGQNRYLLVNIHTHGF---TKYGRVIVRGAD-VDNHLAVFDSILEELEPEGI-CAKILGGGRILNEAENKKIKIYGTSRTFGGA---DH
|..||||.|  .|...|.|...|.||.   |......||| .  ..|. ..| . .|.|  |. |...|||||| .....||||.||.|..|| |   ||
LAKVPRVDIDPEGKFKYVLIQVHIHGESDGTDESKYVVRGYKWCEYHADIYDEVQKEMEKLGLRCCECLGGGRIEHDQQKKKIKVYGYSQGFGRAPGCDH

TRTRNILQAWTTYKDFKI
..|..||. || |.|..|
AITKEILKSWTKYPDYNI

Sequence
Name Sequence Type Origin Length Description Download
janB.AA Protein None 140 None Fasta, JSON
janB.NA RNA None 420 None Fasta, JSON