• Phosphatome.Net

Gene CG34183

CG34183
Species: D.melanogaster
Alias: CG34183
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: RTR1
Family: RTR1
Subfamily: RTR1
Protein domain

Protein domains of CG34183.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase CG34183.AA RPAP2_Rtr1 47-122 42 1.1e-34 122.53 Pfam 1-88 (88) Show / Hide 
Range on Protein: 47-122
Range on HMM: 1-88/88
Sequence Identity: 42% (37 aa)

LLCEIGPPNYSDIVDEREINKLCGYPLCSTVLENVP-KQKYSISAS-KNKVYDITERK----------KFCSGYCFKASEYIKSQVPT
.|. . |..| |.|.|| |||.||||||. ...|.| ||.|.|...  ||||||..||          .||| .|...|.|.. |...
MLRYFTPSHYDDVVEERNINKKCGYPLCPNPPKNIPGKQRYRIDWKGENKVYDIENRKYEYWPNTMLSMFCSKDCYRCSQYYRVQLSE
Phosphatase CG34183.AA Family.RTR1.PD 48-121 59 3.2e-36 111.4 In-house 2-75 (76) Show / Hide 
Range on Protein: 48-121
Range on HMM: 2-75/76
Sequence Identity: 59% (44 aa)

LCEIGPPNYSDIVDEREINKLCGYPLCSTVLENVPKQKYSISASKNKVYDITERKKFCSGYCFKASEYIKSQVP
|. . | .|||.|.||.|||.|||||||. ||...||||.||....||||||||||||| .|.|||.....|..
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls
Phosphatase CG34183.AA Group.RTR1.PD 48-121 59 3.2e-36 111.4 In-house 2-75 (76) Show / Hide 
Range on Protein: 48-121
Range on HMM: 2-75/76
Sequence Identity: 59% (44 aa)

LCEIGPPNYSDIVDEREINKLCGYPLCSTVLENVPKQKYSISASKNKVYDITERKKFCSGYCFKASEYIKSQVP
|. . | .|||.|.||.|||.|||||||. ||...||||.||....||||||||||||| .|.|||.....|..
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls
Phosphatase CG34183.AA Subfamily.RTR1.PD 48-121 59 3.2e-36 111.4 In-house 2-75 (76) Show / Hide 
Range on Protein: 48-121
Range on HMM: 2-75/76
Sequence Identity: 59% (44 aa)

LCEIGPPNYSDIVDEREINKLCGYPLCSTVLENVPKQKYSISASKNKVYDITERKKFCSGYCFKASEYIKSQVP
|. . | .|||.|.||.|||.|||||||. ||...||||.||....||||||||||||| .|.|||.....|..
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqls
Sequence
Name Sequence Type Origin Length Description Download
CG34183.AA Protein None 143 None Fasta, JSON
CG34183.NA RNA None 429 None Fasta, JSON
CG34183.AA.PD_47-122 Protein Phosphatase Domain None 76 None Fasta, JSON