• Phosphatome.Net

Gene mbre_23929

mbre_23929
Species: M.brevicollis
Alias: mbre_23929
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: OCA
Subfamily: OCA
Protein domain

Protein domains of mbre_23929.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase mbre_23929.AA Family.OCA.PD 323-378 37 1.4e-12 38.5 In-house 74-129 (165) Show / Hide 
Range on Protein: 323-378
Range on HMM: 74-129/165
Sequence Identity: 37% (21 aa)

KYSRHMLCRGLKIVATQAHHPVLVHCFHGKDRTGLLVALVLSILKVPRESIIMDYH
. . ..|.| |||. .....|||.||..||.||||.|. .  . |    ||. .|.
eieeellkrvlkilldvdnypvlihcnkGkhrtglvvgclRklqkWnlasileEyr
Phosphatase mbre_23929.AA Subfamily.OCA.PD 323-378 37 1.4e-12 38.5 In-house 74-129 (165) Show / Hide 
Range on Protein: 323-378
Range on HMM: 74-129/165
Sequence Identity: 37% (21 aa)

KYSRHMLCRGLKIVATQAHHPVLVHCFHGKDRTGLLVALVLSILKVPRESIIMDYH
. . ..|.| |||. .....|||.||..||.||||.|. .  . |    ||. .|.
eieeellkrvlkilldvdnypvlihcnkGkhrtglvvgclRklqkWnlasileEyr
Phosphatase mbre_23929.AA Family.DSP.PD 326-361 27 3.3e-07 20.8 In-house 169-205 (387) Show / Hide 
Range on Protein: 326-361
Range on HMM: 169-205/387
Sequence Identity: 27% (10 aa)

RHmLCRGLKIVAT--QAHHPVLVHCFHGKDRTGLLVAL
.. ... .... .  .... ||||| .|| |.| |.. 
nl-fekaidfieegndskgvVlVHCkaGkgRsgtliia
Phosphatase mbre_23929.AA Y_phosphatase2 327-360 32 3e-06 22.61 Pfam 94-127 (184) Show / Hide 
Range on Protein: 327-360
Range on HMM: 94-127/184
Sequence Identity: 32% (11 aa)

HMLCRGLKIVATQAHHPVLVHCFHGKDRTGLLVA
| . | |... .....|...||  || |||....
HCMRRCLQTLLNKDNYPCYIHCNRGKHRTGCVIG
Phosphatase mbre_23929.AA Subfamily.R_Ecdysozoa.PD 339-374 34 5.3e-06 16.7 In-house 199-234 (269) Show / Hide 
Range on Protein: 339-374
Range on HMM: 199-234/269
Sequence Identity: 34% (12 aa)

QAHHPVLVHCFHGKDRTGLLVALVLSILKVPRESII
.. |..|||  | .|.|..||| | . ..  |  . 
gsrsPivvhCsaGvgrsgifvaldlllqqlkaedkv
Sequence
Name Sequence Type Origin Length Description Download
mbre_23929.AA Protein None 450 None Fasta, JSON
mbre_23929.NA RNA None 1350 None Fasta, JSON
mbre_23929.AA.PD_327-360 Protein Phosphatase Domain None 34 None Fasta, JSON