• Phosphatome.Net

Gene mbre_29484

mbre_29484
Species: M.brevicollis
Alias: mbre_29484
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: HAD
Family: EYA
Subfamily: EYA
Protein domain

Protein domains of mbre_29484.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase mbre_29484.AA Family.EYA.PD 488-548 37 6.4e-15 42.1 In-house 3-63 (247) Show / Hide 
Range on Protein: 488-548
Range on HMM: 3-63/247
Sequence Identity: 37% (23 aa)

VFIWDLDETLVVFNELTNGRFARAYSLDVNTGKYTGRALEKLVFRVLDNKLFFKKLEKMSE
||.||||||...|  |  | .|. |. | ..    |  .|...| . | .|||..||.  .
vfvwdldetiiifhslltgsyaekygkdasssvalglrmeemifnladthlffndleecdq
Phosphatase mbre_29484.AA Subfamily.EYA.PD 488-548 37 6.4e-15 42.1 In-house 3-63 (247) Show / Hide 
Range on Protein: 488-548
Range on HMM: 3-63/247
Sequence Identity: 37% (23 aa)

VFIWDLDETLVVFNELTNGRFARAYSLDVNTGKYTGRALEKLVFRVLDNKLFFKKLEKMSE
||.||||||...|  |  | .|. |. | ..    |  .|...| . | .|||..||.  .
vfvwdldetiiifhslltgsyaekygkdasssvalglrmeemifnladthlffndleecdq
SH3 mbre_29484.AA SH3 599-656 29 1.2e-10 42.62 SMART 1-58 (58) Show / Hide 
Range on Protein: 599-656
Range on HMM: 1-58/58
Sequence Identity: 29% (17 aa)

PTHRAIADLKKTIPQGLDLRQGEKLYALEEPEGGWVLARREDGSEQGLAPTTYLEAIN
|. ||. | . . |. | ...|.... ||. ..||  .|. .  ..|. |..|.| |.
PYVRALYDYQAQNPDELSFKKGDIITVLEKDDDGWWKGRCNRTGQEGWFPSNYVEEID
SH3 mbre_29484.AA SH3_1 602-649 20 2.2e-07 28.05 Pfam 1-49 (49) Show / Hide 
Range on Protein: 602-649
Range on HMM: 1-49/49
Sequence Identity: 20% (10 aa)

RAIADLKKTIPQGLDLRQGEKLYALEEPEG-GWVLARREDGSEQGLAPT
.|. | ... |. | ...|.... .|. .. .|  .|. .. ..|. |.
VALYDYQAQQPDELSFKKGDIIHVIEKSDDWDWWKGRCNNTGQEGWFPS
SH3 mbre_29484.AA SH3_2 600-655 14 9e-06 23.18 Pfam 1-68 (68) Show / Hide 
Range on Protein: 600-655
Range on HMM: 1-68/68
Sequence Identity: 14% (10 aa)

THRAIADLKK-TIPQG-----LDLRQGEKLYAL----EEPEGGWVLA-RREDGSEQ--GLAPTTYLEAI
 .|.. | .  | ...     |... |.... .    .... .|... .. .| .   |..|....| .
YYRVHCDYVPATYCNENHEPQLHFKKGDVIKVIDNGDKDWD-NWWWCWETIWGGRRMRGWFPSQWVEEC
Sequence
Name Sequence Type Origin Length Description Download
mbre_29484.AA Protein None 745 None Fasta, JSON
mbre_29484.NA RNA None 2235 None Fasta, JSON