• Phosphatome.Net

Gene mbre_22478

mbre_22478
Species: M.brevicollis
Alias: mbre_22478
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: PHP
Family: PHP
Subfamily: PHP
Protein domain

Protein domains of mbre_22478.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Ocnus mbre_22478.AA Ocnus 5-110 40 2.8e-35 128.31 Pfam 1-118 (118) Show / Hide 
Range on Protein: 5-110
Range on HMM: 1-118/118
Sequence Identity: 40% (48 aa)

LAAVPPVEID-QGVFKYVLIELQEA-----NGAKRTLLRGYTHAEYHDDVYQAVRPGLDALGL-KSRVLGGGRIRHVPDQE-IFVYGYSMAYGQG---DH
||.|| |.||  |.|||||| .         . ... .|||  .|||.|.|. | . ...||| . ..||||||.| ..   |.|||||...|     ||
LAKVPRVDIDPEGKFKYVLIQVHIHGESDGTDESKYVVRGYKWCEYHADIYDEVQKEMEKLGLRCCECLGGGRIEHDQQKKKIKVYGYSQGFGRAPGCDH

ALAVDMLR--KAYPSYPKI
| ... |   ..|| | .|
AITKEILKSWTKYPDY-NI
Sequence
Name Sequence Type Origin Length Description Download
mbre_22478.AA Protein None 117 None Fasta, JSON
mbre_22478.NA RNA None 351 None Fasta, JSON