• Phosphatome.Net

Gene MONBRDRAFT_6744

MONBRDRAFT_6744
Species: M.brevicollis
Alias: MONBRDRAFT_6744
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: RTR1
Family: RTR1
Subfamily: RTR1
Protein domain

Protein domains of MONBRDRAFT_6744.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase MONBRDRAFT_6744.AA Family.RTR1.PD 41-115 48 1.3e-31 96.6 In-house 7-76 (76) Show / Hide 
Range on Protein: 41-115
Range on HMM: 7-76/76
Sequence Identity: 48% (36 aa)

HQHYDNIVEERLADERCGYPICPHRLASEAvESAYFgsvhIDQKHGRIVDITESMRYCSRECYAASRHYRRQLLD
..||...|||| ...|||||.|...|.|.| ...|.    |.||.....||||....||.|||.||..||||| |
pdhysdvveeRsinkrCGYPlCskslesia-kqkyk----isqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase MONBRDRAFT_6744.AA Group.RTR1.PD 41-115 48 1.3e-31 96.6 In-house 7-76 (76) Show / Hide 
Range on Protein: 41-115
Range on HMM: 7-76/76
Sequence Identity: 48% (36 aa)

HQHYDNIVEERLADERCGYPICPHRLASEAvESAYFgsvhIDQKHGRIVDITESMRYCSRECYAASRHYRRQLLD
..||...|||| ...|||||.|...|.|.| ...|.    |.||.....||||....||.|||.||..||||| |
pdhysdvveeRsinkrCGYPlCskslesia-kqkyk----isqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase MONBRDRAFT_6744.AA Subfamily.RTR1.PD 41-115 48 1.3e-31 96.6 In-house 7-76 (76) Show / Hide 
Range on Protein: 41-115
Range on HMM: 7-76/76
Sequence Identity: 48% (36 aa)

HQHYDNIVEERLADERCGYPICPHRLASEAvESAYFgsvhIDQKHGRIVDITESMRYCSRECYAASRHYRRQLLD
..||...|||| ...|||||.|...|.|.| ...|.    |.||.....||||....||.|||.||..||||| |
pdhysdvveeRsinkrCGYPlCskslesia-kqkyk----isqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase MONBRDRAFT_6744.AA RPAP2_Rtr1 42-115 32 3.1e-15 55.25 Pfam 8-88 (88) Show / Hide 
Range on Protein: 42-115
Range on HMM: 8-88/88
Sequence Identity: 32% (28 aa)

QHYDNIVEERLADERCGYPICPHRLASEAVESAYFGSVHIDQK-HGRIVDIT---ESM-------RYCSRECYAASRHYRRQLLD
.|||..|||| .  .|||| ||. . ..   . |.    ||.|  ....||.   ...        .|| .|| .| .||.|| .
SHYDDVVEERNINKKCGYPLCPNPPKNIPGKQRYR----IDWKGENKVYDIENRKYEYWPNTMLSMFCSKDCYRCSQYYRVQLSE
Sequence
Name Sequence Type Origin Length Description Download
MONBRDRAFT_6744.AA Protein None 409 None Fasta, JSON
MONBRDRAFT_6744.NA RNA None 1206 None Fasta, JSON
MONBRDRAFT_6744.AA.PD_42-115 Protein Phosphatase Domain None 74 None Fasta, JSON