• Phosphatome.Net

Gene nvec_s158

nvec_s158
Species: N.vectensis
Alias: nvec_s158
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: Myotubularin
Subfamily: MTMR1
Protein domain

Protein domains of nvec_s158.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase nvec_s158.AA Subfamily.C2-MTMR1.PD 17-85 33 1.2e-14 42.8 In-house 62-124 (137) Show / Hide 
Range on Protein: 17-85
Range on HMM: 62-124/137
Sequence Identity: 33% (23 aa)

LEVYLGHCLGsrFQSLVDREWIRGEHPFSNRCTKDGFSSTkykgQGPVFLLFLDCVWQIYQQFPCSFEF
|. |     |  .. |...||.   | | .|  .   .|     . |.|| ||||..|. .|||..||.
ldpyyrtidg--livliekewlafghkfderlggadsvse----rspiflqfldclyqvtkqfpsafey
Phosphatase nvec_s158.AA Family.Myotubularin.PD 29-85 42 1.2e-18 55.5 In-house 73-128 (141) Show / Hide 
Range on Protein: 29-85
Range on HMM: 73-128/141
Sequence Identity: 42% (24 aa)

FQSLVDREWIRGEHPFSNRCTkDGFSSTKYKGQGPVFLLFLDCVWQIYQQFPCSFEF
|. |...||.   | |..|.   | .|.. . . |||| |.|||.|. .|||..|||
fevliekeWlsfGhkfaerlg-hgdkseseeersPvflqfidcvyqltkqfptafef
Phosphatase nvec_s158.AA Subfamily.MTMR3.PD 28-85 47 1.8e-18 55.1 In-house 66-122 (135) Show / Hide 
Range on Protein: 28-85
Range on HMM: 66-122/135
Sequence Identity: 47% (27 aa)

RFQSLVDREWIRGEHPFSNRCTKDGfSSTKYKGQGPVFLLFLDCVWQIYQQFPCSFEF
|. ||.|||.   | |..|| ..   | . . . |||| .||||.|. .|||.|||| 
gfkvlverewldfghkfadrcghge-dsddlnercpvflqwldcvhqlkkqfptsfef
Phosphatase nvec_s158.AA Subfamily.MTMR1.PD 28-85 42 3.1e-16 47.8 In-house 80-136 (149) Show / Hide 
Range on Protein: 28-85
Range on HMM: 80-136/149
Sequence Identity: 42% (24 aa)

RFQSLVDREWIRGEHPFSNRCTKdGFSSTKYKGQGPVFLLFLDCVWQIYQQFPCSFEF
|. |...||.   | |..|  . |      . . |||| |.|||||. .|||..||| 
gfevliekewlsfghkfaerigh-gdknhadadrspvflqfidcvwqvtrqfptafef
Sequence
Name Sequence Type Origin Length Description Download
nvec_s158.AA Protein None 85 None Fasta, JSON
nvec_s158.NA RNA None 255 None Fasta, JSON