nvec_s2632
Species: N.vectensis
Alias: nvec_s2632
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: LMWPTP_SSU72
Family: Ssu72
Subfamily: Ssu72
Protein domain

Protein domains of nvec_s2632.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase nvec_s2632.AA Family.Ssu72.PD 1-33 57 4.7e-12 33.6 In-house 159-191 (191) Show / Hide
Range on Protein: 1-33
Range on HMM: 159-191/191
Sequence Identity: 57% (19 aa)

IEKLTDVEDEINDVVAKFEDKYKRNILHSVAFY
.|| .|.||||......||.|.||..|||||||
leksedledeideileefeektkrellhsvafy

Phosphatase nvec_s2632.AA Subfamily.Ssu72.PD 1-33 57 4.7e-12 33.6 In-house 159-191 (191) Show / Hide
Range on Protein: 1-33
Range on HMM: 159-191/191
Sequence Identity: 57% (19 aa)

IEKLTDVEDEINDVVAKFEDKYKRNILHSVAFY
.|| .|.||||......||.|.||..|||||||
leksedledeideileefeektkrellhsvafy

Phosphatase nvec_s2632.AA Ssu72 2-33 30 9.8e-10 34.92 Pfam 182-214 (214) Show / Hide
Range on Protein: 2-33
Range on HMM: 182-214/214
Sequence Identity: 30% (10 aa)

EKLTDVEDEINDVVAKFEDKY-KRNILHSVAFY
|. .| ||.|........... .|..|..|.||
EASEDWEDQIMEILHEWQEQHPHRPFLYCVCFY

Phosphatase nvec_s2632.AA Group.LMWPTP_SSU72.PD 1-33 39 1.1e-09 26.4 In-house 129-161 (163) Show / Hide
Range on Protein: 1-33
Range on HMM: 129-161/163
Sequence Identity: 39% (13 aa)

IEKLTDVEDEINDVVAKFEDKYKRNILHSVAFY
||. .|.|..... ...||..||...||..|||
iedpedleeyydeeleeFeesykqlvlhckaFy

Sequence
Name Sequence Type Origin Length Description Download
nvec_s2632.AA Protein None 33 None Fasta, JSON
nvec_s2632.NA RNA None 99 None Fasta, JSON
nvec_s2632.AA.PD_2-33 Protein Phosphatase Domain None 32 None Fasta, JSON