• Phosphatome.Net

Gene nvec_125085

nvec_125085
Species: N.vectensis
Alias: nvec_125085
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: PHP
Family: PHP
Subfamily: PHP
Protein domain

Protein domains of nvec_125085.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Ocnus nvec_125085.AA Ocnus 12-118 49 8.1e-65 226.45 Pfam 1-118 (118) Show / Hide 
Range on Protein: 12-118
Range on HMM: 1-118/118
Sequence Identity: 49% (59 aa)

LDAIPDVDIDESGIFKYILLKITD------GDKEKNIVRGYEWADFHADIYERVQPGIEELGL-GTECVGGGRIRHNAAKKKILVYGFSMGFGRA---DH
|...|.||||..|.|||.|.....      .|..|..||||.|...|||||..||. .|.|||  .||.|||||.|...|||| ||| |.|||||   ||
LAKVPRVDIDPEGKFKYVLIQVHIHGESDGTDESKYVVRGYKWCEYHADIYDEVQKEMEKLGLRCCECLGGGRIEHDQQKKKIKVYGYSQGFGRAPGCDH

KISVAKLK--AVYPNYTEI
.|....||  ..||.| .|
AITKEILKSWTKYPDY-NI
Sequence
Name Sequence Type Origin Length Description Download
nvec_125085.AA Protein None 125 None Fasta, JSON
nvec_125085.NA RNA None 375 None Fasta, JSON