Gene DCR2
DCR2
Classification
Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.
Protein domain
Protein domains of DCR2.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Phosphatase | DCR2.AA | Metallophos | 248-502 | 10 | 2e-19 | 73.28 | Pfam | 1-124 (124) | Show / Hide |
Range on Protein: 248-502
Range on HMM: 1-124/124
Sequence Identity: 10% (26 aa)
FKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRW
..|....|.|.. ... . ..... || .|.|||| . ... . | ... . ...|...| ||||. . ....
MRILHCGDIHGQYDDL-------------------NRLFEII-E-KPDFVIFTGDYVDRGPWSDECIWLL---FCYKMNYPGPVYWVRGNHDYMHGNDFY
QLSEIASVLPYSLFKFSPHDTHDNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIPL
. . . ... |. ... ...| |.
GFY-E-----------------------------------------------------------------NDW-MWWWWF-WMPLA-LDDWKILCMHGPP
PEYLNIESKTHPGEKNPLIGMYKEGVTAPKYNSEGITTLDRLSVDVVSCGHDHCN
.. . ||.| .||.|.
-------------------------------------FCK-NGVDYVIRGHTHVP
|
|||||||||