RTR1
Species: S.cerevisiae
Alias: RTR1, YER139C
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: RTR1
Family: RTR1
Subfamily: RTR1
Protein domain

Protein domains of RTR1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase RTR1.AA RPAP2_Rtr1 51-129 42 5.3e-36 127.04 Pfam 1-88 (88) Show / Hide
Range on Protein: 51-129
Range on HMM: 1-88/88
Sequence Identity: 42% (37 aa)

LGRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERI--RDPFSMNDT--TKKFLLENNPYA-----YLSHYCSKFHFRCSQFYQVQLSD
..|..||  |.|.|.|||.||.|||||| ..|..|  ....... .  .|....||..|.     .|| .|||...||||.|.||||.
MLRYFTPSHYDDVVEERNINKKCGYPLCPNPPKNIPGKQRYRIDWKGENKVYDIENRKYEYWPNTMLSMFCSKDCYRCSQYYRVQLSE

Phosphatase RTR1.AA Family.RTR1.PD 52-129 44 4.2e-32 98.2 In-house 2-76 (76) Show / Hide
Range on Protein: 52-129
Range on HMM: 2-76/76
Sequence Identity: 44% (35 aa)

GRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERI-RDPFSMNDTTKKFLlenNPyAYLSHYCSKFHFRCSQFYQVQLSD
.|.||||.|.|.|.||..||||||||| ||.|.| .. .......||..   .. ......|||.....|.||..||||
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvy---di-terkkfCskecykaskfyrrqlsd

Phosphatase RTR1.AA Group.RTR1.PD 52-129 44 4.2e-32 98.2 In-house 2-76 (76) Show / Hide
Range on Protein: 52-129
Range on HMM: 2-76/76
Sequence Identity: 44% (35 aa)

GRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERI-RDPFSMNDTTKKFLlenNPyAYLSHYCSKFHFRCSQFYQVQLSD
.|.||||.|.|.|.||..||||||||| ||.|.| .. .......||..   .. ......|||.....|.||..||||
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvy---di-terkkfCskecykaskfyrrqlsd

Phosphatase RTR1.AA Subfamily.RTR1.PD 52-129 44 4.2e-32 98.2 In-house 2-76 (76) Show / Hide
Range on Protein: 52-129
Range on HMM: 2-76/76
Sequence Identity: 44% (35 aa)

GRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERI-RDPFSMNDTTKKFLlenNPyAYLSHYCSKFHFRCSQFYQVQLSD
.|.||||.|.|.|.||..||||||||| ||.|.| .. .......||..   .. ......|||.....|.||..||||
lrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvy---di-terkkfCskecykaskfyrrqlsd

Sequence
Name Sequence Type Origin Length Description Download
RTR1.AA Protein None 226 None Fasta, JSON
RTR1.NA RNA None 681 None Fasta, JSON
RTR1.AA.PD_51-129 Protein Phosphatase Domain None 79 None Fasta, JSON