• Phosphatome.Net

Gene Scaffold35563

Scaffold35563
Species: S.purpuratus
Alias: Scaffold35563
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: Myotubularin
Subfamily: MTMR10
Protein domain

Protein domains of Scaffold35563.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase Scaffold35563.AA Family.Myotubularin.PD 2-93 47 7.5e-31 95.0 In-house 46-139 (141) Show / Hide 
Range on Protein: 2-93
Range on HMM: 46-139/141
Sequence Identity: 47% (44 aa)

SQGRDYSCVVASLSQIMLDSHYRSQLGFQSLLQKEWIVAGHPFLDRCGHCVPS--SGTESPIFLLFLDCVHQLIEQFPSAFEFTDTFLIALWDS
| | |  . ..||.|..||..||.  ||. |..|||.  || | .|.||   |  .  .||.|| |.|||.||..|||.||||...||| . | 
sdGWdrtaqltslaqllldpyyrtieGfevliekeWlsfGhkfaerlghgdkseseeersPvflqfidcvyqltkqfptafefnesflikildh
Phosphatase Scaffold35563.AA Subfamily.MTMR1.PD 2-94 44 1.7e-28 87.5 In-house 54-148 (149) Show / Hide 
Range on Protein: 2-94
Range on HMM: 54-148/149
Sequence Identity: 44% (42 aa)

SQGRDYSCVVASLSQIMLDSHYRSQLGFQSLLQKEWIVAGHPFLDRCGHCVP--SSGTESPIFLLFLDCVHQLIEQFPSAFEFTDTFLIALWDSM
|.| | .. ..||. ..|||.||.  ||. |..|||.  || | .| ||     . .  ||.|| |.||| |. .|||.||||...|||..| . 
sdgwdrtaqltslamllldsyyrtikgfevliekewlsfghkfaerighgdknhadadrspvflqfidcvwqvtrqfptafefneeflitildhl
Phosphatase Scaffold35563.AA Subfamily.C2-MTMR1.PD 2-93 45 3.1e-28 86.9 In-house 45-135 (137) Show / Hide 
Range on Protein: 2-93
Range on HMM: 45-135/137
Sequence Identity: 45% (41 aa)

SQGRDYSCVVASLSQIMLDSHYRSQLGFQSLLQKEWIVAGHPFLDRCGHCVpSSGTESPIFLLFLDCVHQLIEQFPSAFEFTDTFLIALWDS
|.| | .  ...|.|..|| .||.  |.. |..|||.  || | .| |.   |.   ||||| ||||..|.  |||||||.|  .|.| |  
sdgwdrtsqlvllaqllldpyyrtidglivliekewlafghkfderlggad-svserspiflqfldclyqvtkqfpsafeytarlllklady
Phosphatase Scaffold35563.AA Subfamily.MTMR3.PD 2-91 45 5.2e-28 86.0 In-house 40-131 (135) Show / Hide 
Range on Protein: 2-91
Range on HMM: 40-131/135
Sequence Identity: 45% (41 aa)

SQGRDYSCVVASLSQIMLDSHYRSQLGFQSLLQKEWIVAGHPFLDRCGHCVPS--SGTESPIFLLFLDCVHQLIEQFPSAFEFTDTFLIALW
|.| | .  . .|....|| .||.  ||. |...||.  || | |||||   |   . ..|.|| .||||||| .|||..|||...||. | 
sdgwdrtpqivalakllldpyyrtlegfkvlverewldfghkfadrcghgedsddlnercpvflqwldcvhqlkkqfptsfefneaflvklv
3-PAP Scaffold35563.AA 3-PAP 233-295 28 4.1e-11 41.99 Pfam 84-152 (152) Show / Hide 
Range on Protein: 233-295
Range on HMM: 84-152/152
Sequence Identity: 28% (20 aa)

PLLQTPTITLWNHCYLRWVPSVHTVGGGSPAIYQQQCRLVDE--I---QQLRETLENLKVSK-ESVAAP
|..  . | .|  ||.||.| .....||.|.|......|.||  |   | |.. |.  . |. .   ..
PQCCGCHIKVWKQCYFRWIPWAQIRNGGQPQIFLHNMELMDEWYIHFHQKLQRCLHQRDMSDLPECYLE
Sequence
Name Sequence Type Origin Length Description Download
Scaffold35563.AA Protein None 377 None Fasta, JSON
Scaffold35563.NA RNA None 1131 None Fasta, JSON