• Phosphatome.Net

Gene Spur_hmm112736,hmm25262

Spur_hmm112736,hmm25262
Species: S.purpuratus
Alias: Spur_hmm112736,hmm25262
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-I
Family: Myotubularin
Subfamily: MTMR5
Protein domain

Protein domains of Spur_hmm112736,hmm25262.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SBF2 Spur_hmm112736,hmm25262.AA SBF2 65-315 42 4.8e-107 359.59 Pfam 1-233 (233) Show / Hide 
Range on Protein: 65-315
Range on HMM: 1-233/233
Sequence Identity: 42% (110 aa)

QIVPYNA-----SIGNFEGHRNLVNNSA---RRLEVLRTCINFIFENKILDARRLFPAVMRSLKSRVARQALLHELELHVNKNRA-MLEPQQFSMVVRLI
 ..|. .     |.. .|.|.....|||   |||||||.||..||.||||.|. .||||.|.||.|.||..| .||.||.  ||. .|. ||| ||||..
PMGPPVNTIVPGSMSIMEKHSGMFHNSALMLRRLEVLRNCISYIFDNKILEAKKMFPAVLRALKGRAARICLCRELNLHCQQNRHFVLDHQQFDMVVRMM

NAALQEDSHSEEFSLSMDFLPLISAFCRKLCPGIIQFAYTVTQDHPVFASHAFWETAFYADVEKNIQSLYVTPDNTPTYEKKDVSQSFNDAFAAGPDASG
|.|||... ..|       ||| .|||||||||..|||||. ||||| ..  |||..|| || . | .||                            ..
NCALQDCCSMDEYGVAAALLPLSTAFCRKLCPGVHQFAYTCVQDHPVWKNQQFWEACFYQDVQNHIRELYL---------------------------NM

SSASSAAANGLITSAERSPLDIAAEQLRLQPNMNHDAREEAKSNEESIVYSQAVHYANRM
.. .   .. .. ..|.. ..|||||.|| | |  .  .|  ..||| ||||| ||||||
HHDEQKTWSDWCHKQEPCAMEIAAEQMRLWPTMDKEKQQELVQKEESTVYSQAIHYANRM
GRAM Spur_hmm112736,hmm25262.AA GRAM 426-514 15 1.6e-09 37.08 Pfam 1-78 (78) Show / Hide 
Range on Protein: 426-514
Range on HMM: 1-78/78
Sequence Identity: 15% (15 aa)

QKP-KILKPTFLPGEEKVMEG----LRGYLVLDGREEGQGGVMGGPTLLPAEGAVFLTTYRIIFKGTPIDMQACEQVVTRSFPVSALVKEKKIN
 |  |. |. .||..||. .      . .|  ..            |..|. |....|.....|.. . . ..   .... .| ..... .|. 
EKFRKHFKD-PLPPNEKLIMDCNVTYSCCLWRPF------------TKIPVQGRMYITNHHVCFYSDKFGWET---YYKMVIPWNDITRVEKMQ
Myotub-related Spur_hmm112736,hmm25262.AA Myotub-related 735-791 37 1.1e-19 76.56 Pfam 1-61 (121) Show / Hide 
Range on Protein: 735-791
Range on HMM: 1-61/121
Sequence Identity: 37% (23 aa)

FEVSRSYPALIVVPSVLSDDSIRRLAKCHRHGRLPAITWRHQRTKGLLIRSS----GFHGK
.|....|||..|||. .||| ....||. ..||.|...||||... ...|.|    |. |.
YEICPTYPAKLVVPKSISDDELKKVAKFRSWGRFPVLCWRHQENGAVICRCSQPLVGWWGW
GRAM Spur_hmm112736,hmm25262.AA GRAM 428-514 16 6.9e-10 40.1 SMART 1-80 (80) Show / Hide 
Range on Protein: 428-514
Range on HMM: 1-80/80
Sequence Identity: 16% (15 aa)

PKILKPTFLPGEEKVMEG------LRGYLVLDGREEGQGGVMGGPTLLPAEGAVFLTTYRIIFKGTPIDMQACEQVVTRSFPVSALVKEKKIN
 |. ..  || .||.          . ||  ..              .|. | .......|.|.. . . ..|.|......| . ... .|. 
EKFRQHFKLPPNEKLINDCKKEVTYSCYLWRTY-------------DIPVQGHMYISNNHICFCSNMFGWMTCPQYYKVVIPWADITRIEKMT
Sequence
Name Sequence Type Origin Length Description Download
Spur_hmm112736,hmm25262.AA Protein None 894 None Fasta, JSON
Spur_hmm112736,hmm25262.NA RNA None 2682 None Fasta, JSON