• Phosphatome.Net

Gene Scaffold36548

Scaffold36548
Species: S.purpuratus
Alias: Scaffold36548
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: Cx5R-II
Family: CDC25
Subfamily: CDC25
Protein domain

Protein domains of Scaffold36548.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase Scaffold36548.AA Family.CDC25.PD 25-55 54 2.3e-14 41.3 In-house 2-32 (117) Show / Hide 
Range on Protein: 25-55
Range on HMM: 2-32/117
Sequence Identity: 54% (17 aa)

RLLRSEYDQEIAECHVIDCRYPYEFNGGHIK
.||..|....|.....||||||||..|||||
allkgetkeliekyiiiDcRypyeyegGHik
Phosphatase Scaffold36548.AA Group.Cx5R-II.PD 25-55 54 2.3e-14 41.3 In-house 2-32 (117) Show / Hide 
Range on Protein: 25-55
Range on HMM: 2-32/117
Sequence Identity: 54% (17 aa)

RLLRSEYDQEIAECHVIDCRYPYEFNGGHIK
.||..|....|.....||||||||..|||||
allkgetkeliekyiiiDcRypyeyegGHik
Phosphatase Scaffold36548.AA Subfamily.CDC25.PD 25-55 54 2.3e-14 41.3 In-house 2-32 (117) Show / Hide 
Range on Protein: 25-55
Range on HMM: 2-32/117
Sequence Identity: 54% (17 aa)

RLLRSEYDQEIAECHVIDCRYPYEFNGGHIK
.||..|....|.....||||||||..|||||
allkgetkeliekyiiiDcRypyeyegGHik
Phosphatase Scaffold36548.AA Rhodanese 27-55 25 7e-06 20.34 Pfam 1-31 (102) Show / Hide 
Range on Protein: 27-55
Range on HMM: 1-31/102
Sequence Identity: 25% (8 aa)

LRSEYDQEI--AECHVIDCRYPYEFNGGHIK
.  .... .   ....||.| |.|...|||.
TPEWLKEMMNDPDYVIIDVRPPEEYEKGHIP
Sequence
Name Sequence Type Origin Length Description Download
Scaffold36548.AA Protein None 55 None Fasta, JSON
Scaffold36548.NA RNA None 165 None Fasta, JSON
Scaffold36548.AA.PD_27-55 Protein Phosphatase Domain None 29 None Fasta, JSON