Scaffold44006
Species: S.purpuratus
Alias: Scaffold44006
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: HAD
Family: FCP
Subfamily: DULLARD
Protein domain

Protein domains of Scaffold44006.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase Scaffold44006.AA Subfamily.DULLARD.PD 1-40 67 2.1e-17 52.0 In-house 98-137 (172) Show / Hide
Range on Protein: 1-40
Range on HMM: 98-137/172
Sequence Identity: 67% (27 aa)

FLQHCTLDSGSYTKDLSAVHPDLSSIFIVDNSPGAYRLFP
. |||||.||.||||||.|..||||..|.|||| ||| .|
yrqhCtlesgkytkdlslvsedlssviilDnspvayrknp

Phosphatase Scaffold44006.AA Family.FCP.PD 2-40 47 7.7e-11 31.0 In-house 91-129 (164) Show / Hide
Range on Protein: 2-40
Range on HMM: 91-129/164
Sequence Identity: 47% (18 aa)

LQHCTLDSGSYTKDLSAVHPDLSSIFIVDNSPGAYRLFP
..|.| .|.|.||||... |||...|.|.|| .|.|.| 
rdecvlvkgnyvkdLsklgrdlskviiiDdspdsyklnp

Phosphatase Scaffold44006.AA Subfamily.SCP.PD 1-38 44 8e-11 30.6 In-house 89-126 (163) Show / Hide
Range on Protein: 1-38
Range on HMM: 89-126/163
Sequence Identity: 44% (17 aa)

FLQHCTLDSGSYTKDLSAVHPDLSSIFIVDNSPGAYRL
| ..|   .|.| |||| .  ||... |||||| .| .
frescvfhkgnyvkdlsrlGrdlkkvvivdnspasyif

Phosphatase Scaffold44006.AA Subfamily.HSPC129.PD 1-37 52 1e-08 23.9 In-house 90-126 (164) Show / Hide
Range on Protein: 1-37
Range on HMM: 90-126/164
Sequence Identity: 52% (19 aa)

FLQHCTLDSGSYTKDLSAVHPDLSSIFIVDNSPGAYR
| .||   .|.| |||| .  |||   |||||| |. 
frehcvcvdgnyikdlsilGrdlsktiivdnspqafa

Phosphatase Scaffold44006.AA Group.HAD.PD 3-38 26 9.2e-08 21.2 In-house 108-149 (190) Show / Hide
Range on Protein: 3-38
Range on HMM: 108-149/190
Sequence Identity: 26% (11 aa)

QHCTLDSGSYTK------DLSAVHPDLSSIFIVDNSPGAYRL
..|.   | . .      ||.|...||....|.||.| .. .
dacvylkgpgalllatnrdlgalvrdlekvviidnkpsvfaf

Phosphatase Scaffold44006.AA Subfamily.TIM50.PD 3-38 30 1.3e-06 17.2 In-house 76-111 (150) Show / Hide
Range on Protein: 3-38
Range on HMM: 76-111/150
Sequence Identity: 30% (11 aa)

QHCTLDSGSYTKDLSAVHPDLSSIFIVDNSPGAYRL
..... .|. .|||| .  ||| . .||  . ...|
datkyvdGehvkdlsklnrdlskvivvdldkesvkl

Phosphatase Scaffold44006.AA NIF 3-40 42 2e-06 25.64 Pfam 99-142 (189) Show / Hide
Range on Protein: 3-40
Range on HMM: 99-142/189
Sequence Identity: 42% (19 aa)

QHCT-LDSG-SY-T-KDLSAV--HP-DLSSIFIVDNSPGAYRLFP
.||. .  | .| . |||| .     |||.. |||||| .. | |
EHCWLYRNGGNYYVKKDLSILWYNRWDLSRVIIVDNSPHSW-LQP

Sequence
Name Sequence Type Origin Length Description Download
Scaffold44006.AA Protein None 40 None Fasta, JSON
Scaffold44006.NA RNA None 120 None Fasta, JSON
Scaffold44006.AA.PD_3-40 Protein Phosphatase Domain None 38 None Fasta, JSON