• Phosphatome.Net

Gene LOC763095

LOC763095
Species: S.purpuratus
Alias: LOC763095, XP_001198968
External Links:
Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Superfamily: RTR1
Family: RTR1
Subfamily: RTR1
Protein domain

Protein domains of LOC763095.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit phosphatase group/family/subfamily, which is helpful to understand the relationship between phosphatases. Transmembrane region is predicted by TMHMM 2.0. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking. View complete domain list.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Phosphatase LOC763095.AA Family.RTR1.PD 56-131 52 1.1e-35 109.7 In-house 1-76 (76) Show / Hide 
Range on Protein: 56-131
Range on HMM: 1-76/76
Sequence Identity: 52% (40 aa)

CGKYITSNQFEDVAVERAIEKLCGYPLCTNKLTSIPRQQYHISLKSKKVFDITERKNFCSQRCFQAHAYYQTQLSD
.....|.....||  ||.|.|.||||||...|.||..|.|.|| |.|||.||||||.|||..|..|...|..||||
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase LOC763095.AA Group.RTR1.PD 56-131 52 1.1e-35 109.7 In-house 1-76 (76) Show / Hide 
Range on Protein: 56-131
Range on HMM: 1-76/76
Sequence Identity: 52% (40 aa)

CGKYITSNQFEDVAVERAIEKLCGYPLCTNKLTSIPRQQYHISLKSKKVFDITERKNFCSQRCFQAHAYYQTQLSD
.....|.....||  ||.|.|.||||||...|.||..|.|.|| |.|||.||||||.|||..|..|...|..||||
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase LOC763095.AA Subfamily.RTR1.PD 56-131 52 1.1e-35 109.7 In-house 1-76 (76) Show / Hide 
Range on Protein: 56-131
Range on HMM: 1-76/76
Sequence Identity: 52% (40 aa)

CGKYITSNQFEDVAVERAIEKLCGYPLCTNKLTSIPRQQYHISLKSKKVFDITERKNFCSQRCFQAHAYYQTQLSD
.....|.....||  ||.|.|.||||||...|.||..|.|.|| |.|||.||||||.|||..|..|...|..||||
llrlltpdhysdvveeRsinkrCGYPlCskslesiakqkykisqkekkvyditerkkfCskecykaskfyrrqlsd
Phosphatase LOC763095.AA RPAP2_Rtr1 56-131 40 7.8e-31 109.19 Pfam 1-88 (88) Show / Hide 
Range on Protein: 56-131
Range on HMM: 1-88/88
Sequence Identity: 40% (36 aa)

CGKYITSNQFEDVAVERAIEKLCGYPLCTNKLTSIP-RQQYHISLK-SKKVFDITERK----------NFCSQRCFQAHAYYQTQLSD
...|.|  ...||  ||.|.|.|||||| | ...|| .|.| |..| ..||.||..||          .|||  |...  ||..|||.
MLRYFTPSHYDDVVEERNINKKCGYPLCPNPPKNIPGKQRYRIDWKGENKVYDIENRKYEYWPNTMLSMFCSKDCYRCSQYYRVQLSE
Sequence
Name Sequence Type Origin Length Description Download
LOC763095.AA Protein None 271 None Fasta, JSON
LOC763095.NA RNA None 813 None Fasta, JSON
LOC763095.AA.PD_56-131 Protein Phosphatase Domain None 76 None Fasta, JSON