Protein Domain GRAM
PH: GRAM
Evolution
Structure
The GRAM domain in MTMR2 has 7 beta sheets and 1 alpha helix, resembling Pleckstrin (PH) domain [1].
Functions
Technical notes
Why build in-house profile for GRAM
The GRAM domain in MTMR2 is from 74 to 185 as shown in crystal structure [1]. However, its profiles in Pfam and SMART database are incomplete: Pfam gives 78-138 (envelope 68-139); SMART gives 71-139. The region covers beta sheets 1-5, but not beta sheet 6, 7 and alpha helix 1. We therefore built a profile to capture the full GRAM domain. Below are the sequence of GRAM domain of human MTMR2 determined by structure with 5 flanking residues at both N- and C-terminal (69-190):
KLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNL
Version 1.0
Note: We tried to align the full sequences of myotubularins in phosphatome.net database. The region of GRAM domain defined by MTMR2 GRAM (74-185) does not seem well aligned.