User contributions
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
- 18:30, 15 March 2017 (diff | hist) . . (+251) . . N HMM PD00171 (Created page with "Back to '''List of HMMs''' '''Symbol''': RA '''Name''': Ras Association === Why built the HMM === Human PHLPPs have RA domains, but they are not found by Pfam, SM...")
- 18:26, 15 March 2017 (diff | hist) . . (+44) . . HMM (→HMMs of accessory domains) (current)
- 19:38, 9 March 2017 (diff | hist) . . (+9) . . Phosphatase Subfamily PHLPP (→PH domain of PHLPP)
- 20:23, 23 February 2017 (diff | hist) . . (+21) . . N Phosphatase GeneID AqueP052 (Created page with "Merged into AqueP053.") (current)
- 20:18, 23 February 2017 (diff | hist) . . (+1) . . Phosphatase GeneID SpurP099 (current)
- 20:18, 23 February 2017 (diff | hist) . . (0) . . Phosphatase GeneID SpurP099
- 20:18, 23 February 2017 (diff | hist) . . (+21) . . N Phosphatase GeneID SpurP101 (Created page with "Merged into SpurP098.") (current)
- 20:17, 23 February 2017 (diff | hist) . . (+20) . . N Phosphatase GeneID SpurP099 (Created page with "Merge with SpurP098.")
- 20:36, 7 January 2017 (diff | hist) . . (+25) . . Phosphatase Subfamily PTPN6 (→References) (current)
- 20:36, 7 January 2017 (diff | hist) . . (+168) . . Phosphatase Subfamily PTPN6 (→PTPN11/SHP2)
- 14:13, 6 January 2017 (diff | hist) . . (+27) . . Phosphatase Subfamily PTPRB (→References)
- 14:13, 6 January 2017 (diff | hist) . . (+451) . . Phosphatase Subfamily PTPRB (→PTPRJ (CD148/DEP1/RPTP eta))
- 13:55, 6 January 2017 (diff | hist) . . (+24) . . Phosphatase Subfamily PPP7C (→References)
- 13:54, 6 January 2017 (diff | hist) . . (+304) . . Phosphatase Subfamily PPP7C (→Functions)
- 17:39, 3 January 2017 (diff | hist) . . (+157) . . Phosphatase Subfamily PPP3C (→PPP3CC)
- 17:38, 3 January 2017 (diff | hist) . . (+237) . . Phosphatase Subfamily PPP3C (→Functions)
- 21:16, 10 November 2016 (diff | hist) . . (+463) . . N Wiki Management (Created page with "=== Citations === We use BiblioPlus for automated retrieval and formatting of citations from PubMed and the ISBN databases. However, it failed in Nov, 2016, because [https:...") (current)
- 21:10, 10 November 2016 (diff | hist) . . (+10) . . Main Page (→Technical notes)
- 21:10, 10 November 2016 (diff | hist) . . (+28) . . Main Page (→Technical notes)
- 14:56, 9 September 2016 (diff | hist) . . (+26) . . Phosphatase Subfamily YMR1 (→References)
- 14:56, 9 September 2016 (diff | hist) . . (+69) . . Phosphatase Subfamily YMR1 (→Catalytic activity and functions)
- 14:54, 9 September 2016 (diff | hist) . . (-34) . . Phosphatase Subfamily MTMR1 (→Catalytic activity and functions)
- 16:07, 7 September 2016 (diff | hist) . . (-88) . . Phosphatase Subfamily MTMR1 (→Domain Structure)
- 16:05, 7 September 2016 (diff | hist) . . (-88) . . Phosphatase Subfamily MTMR9 (→Domain Structure) (current)
- 20:06, 31 August 2016 (diff | hist) . . (0) . . Phosphatase Subfamily STS (→References)
- 00:12, 15 May 2016 (diff | hist) . . (-5) . . CTD Phosphorylation (→Phosphatases) (current)
- 00:12, 15 May 2016 (diff | hist) . . (-3) . . CTD Phosphorylation (→Phosphatases)
- 00:10, 15 May 2016 (diff | hist) . . (-42) . . CTD Phosphorylation (→Phosphatases)
- 00:09, 15 May 2016 (diff | hist) . . (-3) . . CTD Phosphorylation (→Phosphatases)
- 00:09, 15 May 2016 (diff | hist) . . (+276) . . CTD Phosphorylation (→Phosphatases)
- 00:03, 15 May 2016 (diff | hist) . . (-4) . . CTD Phosphorylation (→Phosphatases)
- 23:06, 14 May 2016 (diff | hist) . . (-17) . . CTD Phosphorylation (→Phosphatases)
- 23:05, 14 May 2016 (diff | hist) . . (+30) . . CTD Phosphorylation (→Phosphatases)
- 23:03, 14 May 2016 (diff | hist) . . (+154) . . CTD Phosphorylation (→Phosphatases)
- 23:01, 14 May 2016 (diff | hist) . . (-63) . . CTD Phosphorylation (→Kinases)
- 23:01, 14 May 2016 (diff | hist) . . (+6) . . CTD Phosphorylation (→Kinases)
- 22:06, 11 May 2016 (diff | hist) . . (+104) . . N Phosphatase GeneID MbreP062 (Created page with "The domain combination of PTP and PDZ is supported by S. rosetta XP_004995601.1 and M. ovata BAJ52657.1.") (current)
- 18:10, 11 May 2016 (diff | hist) . . (+206) . . N Phosphatase GeneID MbreP044 (Created page with "The presence of WW domain is supported by XP_004997059 (S. Rosetta) and BAJ52652 (M. ovata). The two sequences have an additional EF-hand domain at the C-terminal, which is ab...") (current)
- 21:37, 10 May 2016 (diff | hist) . . (+529) . . N Phosphatase GeneID MbreP035 (Created page with "The full sequence is longer than Entrez gene model (protein sequence XP_001745699.1). It is supported by S. Rosetta XP_004998982.1. MRYQDFYDIGRDQPATASYANPNLLKNRYGNIVAYDAGRVKL...") (current)
- 18:46, 10 May 2016 (diff | hist) . . (+168) . . N Phosphatase GeneID MbreP068 (Created page with "We update the gene model using cDNA GenBank: KM609288.1 reported of cloning Monosiga SHP <cite>Zhao14</cite>. == References == <biblio> #Zhao14 pmid=25445586 </biblio>") (current)
- 17:53, 10 May 2016 (diff | hist) . . (+578) . . Phosphatase Family PTP (→Receptor PTPs)
- 17:52, 10 May 2016 (diff | hist) . . (-201) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 17:52, 10 May 2016 (diff | hist) . . (-314) . . Phosphatase Family PTP (→Receptor PTPs)
- 17:23, 10 May 2016 (diff | hist) . . (+84) . . N Phosphatase GeneID SpurP051 (Created page with "Change the classification from PTP-unclassified to SpurPTP-sf1 (date: May 10, 2016).") (current)
- 17:10, 10 May 2016 (diff | hist) . . (+434) . . Phosphatase GeneID SpurP054 (current)
- 16:50, 10 May 2016 (diff | hist) . . (+54) . . Phosphatase GeneID SpurP050 (current)
- 16:48, 10 May 2016 (diff | hist) . . (+930) . . N Phosphatase GeneID SpurP050 (Created page with "We have the sequence as: XRFSISWPRVLPKGTLAGGVNQAGLDYYTNLIDELLANDIEPVVTLYHWDLPQVLQDDYGGWENDSLTDLFNDYANLCFNEYASKVNLWITFNEPYVVTWLGYGIGVFAPGVYSPGYAPYRAAHTIIKAHAKAYNTYRANYFPQYGGKV...")
- 20:24, 8 May 2016 (diff | hist) . . (+326) . . Phosphatase Family PTP (→Receptor PTPs)
- 20:22, 8 May 2016 (diff | hist) . . (-262) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 20:16, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID CeleP222 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
