Revision history of "Phosphatase GeneID SpurP048"

Jump to: navigation, search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 19:18, 4 January 2016‎ Mark (Talk | contribs)‎ . . (1,482 bytes) (+1,482)‎ . . (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...")
Retrieved from "http://phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP048"