Gene Pgam5-2 in Drosophila melanogaster

Synonym: CG15874, Dmel\CG15874, dPGAM5-2, Dmel_CG15874, Pgam5-2

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily PGAM5
Protein sequence
ID Type Fasta BLAST phosphatome Note
DmelP109_AA protein Get Run
DmelP109_AA_77-268 phosphatase_domain Get Run
Domains
Summary
100200MKYTALWRSVGAMSCGSLVTYFAIRLFDGLEPSMLSGGAQGGKGRAIEPLASGAWRHHWDLDKPQLQKVANGEESSALRHIILVRHGEYTRTPNGSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPSKRSARSLDLAYQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMPVTEITHRRPSPAKSGSNHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_PGAM5_pd(1)0043909(2)0036777(3)0051064(4)0037864(5)SubfamilyTransmembrane region
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
0037864 Phosphoglycerate mutase-like 78-257 1.3e-34 111.8 In-house 7-208 (211) alignment
0047369 Phosphoglycerate mutase-like 78-142 5.6e-10 32.1 In-house 45-148 (438) alignment
subfamily_PGAM5_pd Subfamily PGAM5 79-265 2.7e-93 302.4 In-house 2-188 (189) alignment
0043909 Phosphoglycerate mutase-like 79-265 7.7e-38 122.7 In-house 3-243 (249) alignment
0036777 Phosphoglycerate mutase-like 79-268 2.3e-37 121.3 In-house 3-241 (247) alignment
0051064 Phosphoglycerate mutase-like 79-262 4.7e-35 114.0 In-house 4-236 (241) alignment
0049178 Phosphoglycerate mutase-like 79-262 3.7e-33 107.5 In-house 4-232 (243) alignment
0036887 Phosphoglycerate mutase-like 79-262 5.7e-32 103.3 In-house 2-201 (202) alignment
0053607 Phosphoglycerate mutase-like 79-251 5.1e-30 96.8 In-house 2-183 (191) alignment
0049059 Phosphoglycerate mutase-like 79-142 2.8e-10 32.8 In-house 45-147 (435) alignment
0039931 Phosphoglycerate mutase-like 80-267 3e-33 107.4 In-house 1-196 (219) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 80-217 3.1e-18 59.2 Pfam-A 1-157 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 80-217 3.1e-18 59.2 In-house 1-157 (158) alignment
0053031 Phosphoglycerate mutase-like 80-142 1.7e-10 33.9 In-house 6-91 (342) alignment
0049226 Phosphoglycerate mutase-like 80-143 4.9e-09 29.0 In-house 6-92 (342) alignment
0048955 Phosphoglycerate mutase-like 81-264 1.5e-33 109.1 In-house 3-230 (240) alignment
0035570 Phosphoglycerate mutase-like 81-266 5.7e-33 106.6 In-house 2-197 (219) alignment
0050036 Phosphoglycerate mutase-like 81-247 7.7e-22 69.8 In-house 3-169 (171) alignment
subfamily_TIGAR_pd Subfamily TIGAR 81-144 4.2e-10 31.7 In-house 3-71 (222) alignment
subfamily_PGAM_pd Subfamily PGAM 81-145 1.9e-09 29.2 In-house 3-74 (248) alignment
0046349 Phosphoglycerate mutase-like 81-142 2e-09 30.2 In-house 11-103 (409) alignment
0048439 Phosphoglycerate mutase-like 81-142 8.4e-09 28.3 In-house 13-106 (391) alignment
0048946 Phosphoglycerate mutase-like 81-142 2.2e-08 26.5 In-house 45-155 (447) alignment
subfamily_STS_pd Subfamily STS 92-145 6e-08 24.4 In-house 49-101 (245) alignment