Gene DDB_G0289835 in Dictyostelium discoideum

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily DdisHP1-sf1
Protein sequence
ID Type Fasta BLAST phosphatome Note
DdisP083_AA protein Get Run
DdisP083_AA_20-228 phosphatase_domain Get Run
Domains
Summary
50100150200MTNSNIIENQILIDGANSISKKKVYFIRHGQSTFNIAYLANNKVDPYLFDARLTEEGEKQANELSENVEKYLQDVELIISSPLTRALCTTRRGFGKFLKENSNIKCLVSPLHSETVITSDDNGRPRSIIEKENPDFNFGDLQERWWYLPSSIKDDLSIDTELYFKTNGYKEPIESILHRIEEFKKFLLSRNESTIAVVGHSDFFYHFFDRSIPHMKNCQIVSWCSETNEKVYITKHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_Dicty-HP1-1_pd(1)0051064(2)0048955(3)0036777(4)0049178(5)Subfamily
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_Dicty-HP1-1_pd Subfamily Dicty-HP1-1 22-229 2.9e-127 412.6 In-house 1-210 (210) alignment
0051064 Phosphoglycerate mutase-like 21-220 8.3e-26 83.8 In-house 3-213 (241) alignment
0048955 Phosphoglycerate mutase-like 22-208 8.8e-26 83.7 In-house 1-189 (240) alignment
0036777 Phosphoglycerate mutase-like 22-228 9.4e-24 76.8 In-house 3-220 (247) alignment
0049178 Phosphoglycerate mutase-like 21-220 2.4e-21 68.9 In-house 3-211 (243) alignment
0043909 Phosphoglycerate mutase-like 21-228 2.7e-21 68.6 In-house 2-224 (249) alignment
0036887 Phosphoglycerate mutase-like 22-221 3.5e-21 68.2 In-house 2-181 (202) alignment
0035570 Phosphoglycerate mutase-like 23-223 1.9e-20 65.7 In-house 1-173 (219) alignment
0039931 Phosphoglycerate mutase-like 23-221 2.7e-20 65.2 In-house 1-171 (219) alignment
0037864 Phosphoglycerate mutase-like 22-209 4.2e-20 64.5 In-house 8-172 (211) alignment
0053607 Phosphoglycerate mutase-like 22-220 2e-19 62.3 In-house 2-172 (191) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 23-203 3e-18 59.2 Pfam-A 1-154 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 23-203 3e-18 59.2 In-house 1-154 (158) alignment
0050036 Phosphoglycerate mutase-like 23-207 1.1e-13 43.4 In-house 2-140 (171) alignment
subfamily_TIGAR_pd Subfamily TIGAR 24-91 3e-09 28.8 In-house 3-63 (222) alignment
subfamily_PMU1_pd Subfamily PMU1 27-216 6.5e-09 25.8 In-house 20-218 (233) alignment
subfamily_PGAM_pd Subfamily PGAM 23-91 1.1e-08 26.6 In-house 2-65 (248) alignment
subfamily_PFKFB_pd Subfamily PFKFB 19-90 5.9e-08 24.4 In-house 4-68 (198) alignment
subfamily_TFC7_pd Subfamily TFC7 23-91 9.4e-07 19.6 In-house 2-71 (255) alignment