Gene CG7059 in Drosophila melanogaster

Synonym: Dmel\CG7059, Dmel_CG7059, CG7059

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily HP1-unclassified
Protein sequence
ID Type Fasta BLAST phosphatome Note
DmelP104_AA protein Get Run
DmelP104_AA_16-240 phosphatase_domain Get Run
Domains
Summary
50100150200250MVFFKFLKSKLSQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALTVAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKEDWRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFYTICSNPIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCVHGTVARALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLGDQEYIRRKTAQVAAIGDHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_PGAM_pd(1)0036777(2)0043909(3)0049178(4)0051064(5)Subfamily
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_PGAM_pd Subfamily PGAM 20-264 9.7e-97 315.1 In-house 2-245 (248) alignment
0036777 Phosphoglycerate mutase-like 20-240 1e-61 200.9 In-house 4-222 (247) alignment
0043909 Phosphoglycerate mutase-like 19-239 1.3e-61 200.4 In-house 3-225 (249) alignment
0049178 Phosphoglycerate mutase-like 19-237 1e-57 187.8 In-house 4-218 (243) alignment
0051064 Phosphoglycerate mutase-like 18-238 1.1e-56 184.7 In-house 3-221 (241) alignment
0048955 Phosphoglycerate mutase-like 20-238 3.5e-56 183.0 In-house 2-218 (240) alignment
0037864 Phosphoglycerate mutase-like 17-237 3.3e-52 169.2 In-house 6-199 (211) alignment
0036887 Phosphoglycerate mutase-like 19-237 1.8e-48 157.0 In-house 2-187 (202) alignment
0039931 Phosphoglycerate mutase-like 20-237 3.1e-47 153.0 In-house 1-177 (219) alignment
0035570 Phosphoglycerate mutase-like 20-239 6.3e-47 152.1 In-house 1-179 (219) alignment
0053607 Phosphoglycerate mutase-like 20-236 2.3e-44 143.4 In-house 3-178 (191) alignment
0050036 Phosphoglycerate mutase-like 20-236 2.4e-44 142.9 In-house 2-168 (171) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 20-208 3e-39 127.5 Pfam-A 1-158 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 20-208 3e-39 127.5 In-house 1-158 (158) alignment
subfamily_TIGAR_pd Subfamily TIGAR 21-121 2.4e-20 65.2 In-house 3-101 (222) alignment
subfamily_PFKFB_pd Subfamily PFKFB 17-129 1.5e-09 29.6 In-house 5-107 (198) alignment
subfamily_STS_pd Subfamily STS 41-108 5.2e-09 27.8 In-house 51-116 (245) alignment
subfamily_PFKFB_pd Subfamily PFKFB 166-226 6e-07 21.1 In-house 117-174 (198) alignment