Gene PGAM1 in Homo sapiens

Synonym: HEL-S-35, PGAM-B, PGAMA, RP11-452K12.8, PGAM1

Gene expression: GTEx, DEPOD

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily PGAM
Protein sequence
ID Type Fasta BLAST phosphatome Note
HsapP151_AA protein Get Run
HsapP151_AA_0-250 phosphatase_domain Get Run
Domains
Summary
50100150200250MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_PGAM_pd(1)0043909(2)0036777(3)0049178(4)0051064(5)Subfamily
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_PGAM_pd Subfamily PGAM 4-251 1.5e-124 406.2 In-house 1-248 (248) alignment
0043909 Phosphoglycerate mutase-like 4-242 2.8e-79 258.2 In-house 3-243 (249) alignment
0036777 Phosphoglycerate mutase-like 4-250 1.9e-77 252.3 In-house 3-246 (247) alignment
0049178 Phosphoglycerate mutase-like 1-228 9.2e-72 233.7 In-house 1-224 (243) alignment
0051064 Phosphoglycerate mutase-like 1-230 2.2e-70 229.5 In-house 1-228 (241) alignment
0048955 Phosphoglycerate mutase-like 5-236 2.3e-70 229.3 In-house 2-231 (240) alignment
0037864 Phosphoglycerate mutase-like 3-231 6.2e-64 207.4 In-house 7-208 (211) alignment
0035570 Phosphoglycerate mutase-like 5-224 3.8e-55 178.9 In-house 1-179 (219) alignment
0039931 Phosphoglycerate mutase-like 5-228 1.1e-53 174.1 In-house 1-183 (219) alignment
0036887 Phosphoglycerate mutase-like 5-225 4.3e-53 172.1 In-house 3-190 (202) alignment
0050036 Phosphoglycerate mutase-like 5-222 1.6e-51 166.1 In-house 2-169 (171) alignment
0053607 Phosphoglycerate mutase-like 5-225 1.5e-50 163.6 In-house 3-182 (191) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 5-191 8e-43 139.1 Pfam-A 1-156 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 5-191 8e-43 139.1 In-house 1-156 (158) alignment
subfamily_TIGAR_pd Subfamily TIGAR 6-105 8.6e-17 53.5 In-house 3-101 (222) alignment
subfamily_PFKFB_pd Subfamily PFKFB 3-115 7.6e-12 37.1 In-house 6-109 (198) alignment
subfamily_PGAM5_pd Subfamily PGAM5 5-77 3.8e-06 18.2 In-house 3-70 (189) alignment
0053031 Phosphoglycerate mutase-like 6-116 7.3e-06 18.7 In-house 7-106 (342) alignment