Gene SHB17 in Saccharomyces cerevisiae

Synonym: YKR043C, SHB17

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily HP1-unclassified
Protein sequence
ID Type Fasta BLAST phosphatome Note
ScerP043_AA protein Get Run
ScerP043_AA_3-193 phosphatase_domain Get Run
Domains
Summary
100200MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPEEESQHGDVHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_TIGAR_pd(1)0043909(2)0036777(3)0049178(4)0050036(5)Subfamily
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_TIGAR_pd Subfamily TIGAR 7-196 3.3e-64 208.6 In-house 2-185 (222) alignment
0043909 Phosphoglycerate mutase-like 6-193 4.1e-41 133.4 In-house 3-204 (249) alignment
0036777 Phosphoglycerate mutase-like 6-193 4.8e-41 133.3 In-house 3-200 (247) alignment
0049178 Phosphoglycerate mutase-like 6-193 5.2e-40 129.9 In-house 4-199 (243) alignment
0050036 Phosphoglycerate mutase-like 7-193 8.1e-39 124.9 In-house 2-150 (171) alignment
0048955 Phosphoglycerate mutase-like 6-193 1.1e-38 125.8 In-house 1-198 (240) alignment
0037864 Phosphoglycerate mutase-like 4-193 1.5e-38 124.6 In-house 6-180 (211) alignment
0036887 Phosphoglycerate mutase-like 6-193 8.9e-38 122.2 In-house 2-167 (202) alignment
0035570 Phosphoglycerate mutase-like 8-193 3.3e-37 120.4 In-house 2-158 (219) alignment
0051064 Phosphoglycerate mutase-like 6-193 3.4e-37 121.0 In-house 4-201 (241) alignment
0039931 Phosphoglycerate mutase-like 9-193 2.4e-35 114.3 In-house 3-158 (219) alignment
0053607 Phosphoglycerate mutase-like 9-193 1.2e-33 108.6 In-house 5-160 (191) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 8-183 1.2e-30 99.6 Pfam-A 2-158 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 8-183 1.2e-30 99.6 In-house 2-158 (158) alignment
subfamily_PGAM_pd Subfamily PGAM 7-114 6.4e-17 53.7 In-house 2-101 (248) alignment
0047369 Phosphoglycerate mutase-like 9-95 2.9e-10 33.0 In-house 49-171 (438) alignment
subfamily_PFKFB_pd Subfamily PFKFB 5-185 7.3e-10 30.6 In-house 5-158 (198) alignment
subfamily_STS_pd Subfamily STS 29-204 1.3e-08 26.5 In-house 52-214 (245) alignment
0053031 Phosphoglycerate mutase-like 8-92 2.5e-08 26.8 In-house 7-102 (342) alignment
0048439 Phosphoglycerate mutase-like 9-131 3.3e-08 26.4 In-house 14-153 (391) alignment
0046349 Phosphoglycerate mutase-like 9-91 5.5e-08 25.5 In-house 12-113 (409) alignment
0049059 Phosphoglycerate mutase-like 9-92 2.7e-07 23.0 In-house 48-152 (435) alignment