Gene TIGAR-1 in Strongylocentrotus purpuratus

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP1
Subfamily TIGAR
Protein sequence
ID Type Fasta BLAST phosphatome Note
SpurP167_AA protein Get Run
SpurP167_AA_13-190 phosphatase_domain Get Run
Domains
Summary
50100150200MGVNPYVIPIVQGTVKKVVELGPNPKLEIVQDKRLRERSFGVYEGMSFDVYQHALQNCVGQFVVEGGETPEQALQRLIDFLNDMCRNVKMQEANKTNSAKSTGGASSSAEPTSDAAGGASSKVFVSEFTGEDKAARILPHILLSTHGFMIRSFLKYLHCVINVEIPEGDWLIDDGCPNTSLSTLVVETDKDDKFDFERLICYFIYKVDHFSHP1Curated phosphatase domainHis_Phos_1Pfam Domainsubfamily_TIGAR_pd(1)0043909(2)0051064(3)0036777(4)0049178(5)Subfamily
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_TIGAR_pd Subfamily TIGAR 23-211 1.1e-48 157.8 In-house 71-220 (222) alignment
0043909 Phosphoglycerate mutase-like 14-190 3e-16 52.1 In-house 65-225 (249) alignment
0051064 Phosphoglycerate mutase-like 21-189 7.7e-16 51.2 In-house 73-221 (241) alignment
0036777 Phosphoglycerate mutase-like 16-190 2.5e-15 49.3 In-house 67-221 (247) alignment
0049178 Phosphoglycerate mutase-like 20-188 3.9e-15 48.7 In-house 72-218 (243) alignment
0039931 Phosphoglycerate mutase-like 26-188 1e-14 47.0 In-house 65-177 (219) alignment
0048955 Phosphoglycerate mutase-like 21-189 3e-14 46.0 In-house 70-218 (240) alignment
0036887 Phosphoglycerate mutase-like 26-188 3e-13 42.4 In-house 71-187 (202) alignment
0037864 Phosphoglycerate mutase-like 14-187 3.4e-13 42.0 In-house 70-198 (211) alignment
0053607 Phosphoglycerate mutase-like 26-186 1.5e-12 40.0 In-house 67-177 (191) alignment
0050036 Phosphoglycerate mutase-like 27-158 6.7e-11 34.4 In-house 64-145 (171) alignment
0035570 Phosphoglycerate mutase-like 26-86 1.3e-09 30.5 In-house 65-131 (219) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 26-91 1.9e-06 20.9 Pfam-A 71-139 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 26-91 1.9e-06 20.9 In-house 71-139 (158) alignment