Gene ACP2-1 in Amphimedon queenslandica

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP2
Subfamily ACP2
Protein sequence
ID Type Fasta BLAST phosphatome Note
AqueP193_AA protein Get Run
AqueP193_AA_18-371 phosphatase_domain Get Run
Domains
Summary
100200300400MRTIMNVLWLLILFLLHVSAVLSEEELQFVSVVIRHGARSPVESYPADRYQEDFWPQGFGQLSIKGMREEYHLGTVFKSRYLDTGFMDSGYNRSQIYVRSTDYDRTLMSAQCVLAGMYPPGENQMFDPDLEWQPIPVHTTPQKYDSLLNVASCPVYDKLMDKDNNTYKQIQDANQELFDNLTEWTGEDINVITVGLLKDALFVEYHDNNLTMPEWFSPQLLTKLESIDDSLLRLMFSTKCKRKLTGGVWTNRVLKDMQNKATGVMPDMKMVLYSAHDTTVATMLSVFDMFDGKQPPYSAAFAVELYSSGSSKNDFFVRFYYHNETDSNDFVELTHPNCSKDCPLEKLKQIMAPYRLTEKEWSSSCSTTTAPTSSPTLAPSNDIEMWLVIALCITSGILILLILILLAFMTKVCCCGRKKRMYVALNNQDTEATHP2Curated phosphatase domainHis_Phos_2gpUL132Pfam Domainsubfamily_ACP2_pd(1)0049226(2)0053031(3)0046349(4)0048946(5)SubfamilyTransmembrane regionSignal peptide cleavage site
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_ACP2_pd Subfamily ACP2 23-369 9e-118 385.9 In-house 5-360 (361) alignment
0049226 Phosphoglycerate mutase-like 25-365 1.9e-85 280.0 In-house 1-340 (342) alignment
0053031 Phosphoglycerate mutase-like 25-365 6.3e-83 271.8 In-house 1-340 (342) alignment
0046349 Phosphoglycerate mutase-like 26-367 7.4e-82 268.6 In-house 6-392 (409) alignment
0048946 Phosphoglycerate mutase-like 19-371 1.6e-80 264.1 In-house 33-415 (447) alignment
0049059 Phosphoglycerate mutase-like 20-365 1.7e-78 257.5 In-house 36-434 (435) alignment
0047369 Phosphoglycerate mutase-like 19-365 8.8e-78 255.3 In-house 36-436 (438) alignment
0048439 Phosphoglycerate mutase-like 22-354 1.7e-76 251.0 In-house 4-389 (391) alignment
His_Phos_2 Histidine phosphatase superfamily (branch 2) 26-322 1.8e-47 154.9 Pfam-A 1-347 (347) alignment
His_Phos_2 Histidine phosphatase superfamily (branch 2) 26-322 1.8e-47 154.9 In-house 1-347 (347) alignment
subfamily_ACP6_pd Subfamily ACP6 59-368 4.5e-43 139.4 In-house 75-374 (376) alignment
subfamily_HP2-Group1_pd Subfamily HP2-Group1 59-162 1.6e-17 54.9 In-house 92-195 (422) alignment
subfamily_PXYLP1_pd Subfamily PXYLP1 251-348 2.3e-12 37.8 In-house 298-396 (419) alignment
subfamily_HP2-Group1_pd Subfamily HP2-Group1 253-342 5e-12 36.8 In-house 309-399 (422) alignment
subfamily_MINPP1_pd Subfamily MINPP1 60-172 2.9e-09 28.3 In-house 90-198 (420) alignment
subfamily_PXYLP1_pd Subfamily PXYLP1 59-191 5.6e-09 26.7 In-house 103-225 (419) alignment
gpUL132 Glycoprotein UL132 357-422 1.1e-07 17.7 Pfam-A 21-86 (235) alignment
GP41 Retroviral envelope protein 367-428 1.8e-06 14.0 Pfam-A 134-193 (204) alignment
Tweety Tweety 377-419 5.7e-06 11.2 Pfam-A 8-51 (406) alignment