Gene acp-6 in Caenorhabditis elegans

Synonym: CELE_Y73B6BL.24, acp-6

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HP
Superfamily HP
Family HP2
Subfamily ACP2
Protein sequence
ID Type Fasta BLAST phosphatome Note
CeleP006_AA protein Get Run
CeleP006_AA_31-379 phosphatase_domain Get Run
Domains
Summary
100200300MNLLLFSALILATSAAHLLPKKSVAIDKNSVLVLFGTRHGNRHPEVFLQENPRSWGHEGNTELTSFGKRQGLGLGKELRSFIGNLISRNYNSSQVKYYSSSANRCQMTLQTVTAALHDPEQWGDWDKKWYDHWSPVPYAIDDPLLRMYAVKECKGNDKVWGPIDKDSLPFLKKLKTSNAAELKYFSDNTKWNMENLGKAADLADNLIEIDLYKAEYPSWIKAPKLKGYTFEKLKAKILEFAEVHQNACAEYGPCGNLMAGYWLQNLIDKVADANAGKGPQVIGYASHTEITLSVMKLMGYVKDELTTSAGFVVEFKRLPKPAVRLLNHDPNPIDDHVIYPAELTPKLKKLADKDGFIPLEQFFAYAKQFSFSDWKSQCDKAHP2Curated phosphatase domainHis_Phos_2Pfam Domainsubfamily_ACP2_pd(1)0049226(2)0053031(3)0047369(4)0046349(5)SubfamilySignal peptide cleavage site
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_ACP2_pd Subfamily ACP2 32-380 1.2e-64 211.2 In-house 11-358 (361) alignment
0049226 Phosphoglycerate mutase-like 33-378 8.8e-39 126.7 In-house 6-340 (342) alignment
0053031 Phosphoglycerate mutase-like 33-378 5.6e-38 124.2 In-house 6-340 (342) alignment
0047369 Phosphoglycerate mutase-like 32-379 5.3e-37 121.0 In-house 46-437 (438) alignment
0046349 Phosphoglycerate mutase-like 32-379 1.9e-36 119.1 In-house 9-391 (409) alignment
0049059 Phosphoglycerate mutase-like 33-379 7.6e-36 117.0 In-house 46-435 (435) alignment
0048439 Phosphoglycerate mutase-like 33-368 7e-34 110.8 In-house 12-388 (391) alignment
0048946 Phosphoglycerate mutase-like 32-379 3.3e-33 108.3 In-house 43-410 (447) alignment
His_Phos_2 Histidine phosphatase superfamily (branch 2) 37-150 5.1e-16 51.5 Pfam-A 9-151 (347) alignment
His_Phos_2 Histidine phosphatase superfamily (branch 2) 37-150 5.1e-16 51.5 In-house 9-151 (347) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 36-158 1.4e-08 27.8 Pfam-A 4-93 (158) alignment
His_Phos_1 Histidine phosphatase superfamily (branch 1) 36-158 1.4e-08 27.8 In-house 4-93 (158) alignment
0051064 Phosphoglycerate mutase-like 42-134 8.5e-08 25.0 In-house 10-123 (241) alignment
0036777 Phosphoglycerate mutase-like 42-137 5.4e-07 22.0 In-house 9-121 (247) alignment
0048955 Phosphoglycerate mutase-like 42-137 7.4e-07 21.8 In-house 7-120 (240) alignment
0037864 Phosphoglycerate mutase-like 42-132 1.1e-06 20.8 In-house 14-106 (211) alignment
0049178 Phosphoglycerate mutase-like 42-135 1.1e-06 21.0 In-house 10-124 (243) alignment
0036887 Phosphoglycerate mutase-like 42-131 1.8e-06 20.3 In-house 8-94 (202) alignment
0043909 Phosphoglycerate mutase-like 42-128 4.8e-06 18.8 In-house 9-116 (249) alignment
0053607 Phosphoglycerate mutase-like 42-132 6.4e-06 18.4 In-house 8-91 (191) alignment