Difference between revisions of "Phosphatase Subfamily MTMR5"
| (41 intermediate revisions by 2 users not shown) | |||
| Line 1: | Line 1: | ||
__NOTOC__ | __NOTOC__ | ||
| + | [[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]: [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_MTMR5|Subfamily MTMR5]] (SBF) | ||
| − | + | MTMR5 is an inactive phosphatase (pseudophosphatase), which regulates the active phosphatase MTMR2. | |
| − | + | ||
===Evolution=== | ===Evolution=== | ||
| − | + | MTMR5 is found throughout metazoa. It has two human members, MTMR5 (SBF1) and MTMR13 (SBF2), and single members in Drosophila (Sbf) and C. elegans (mtm-5). | |
| − | ===Domain | + | ===Domain structure=== |
| − | + | The MTMR5s of most metazoa except chordates have a domain combination of DENN, GRAM, phosphatase, coiled coil, [[Protein_Domain#C1|C1]] and PH. Vertebrate MTMR5s lost C1 domain (see technical notes below). | |
| + | |||
| + | The DENN domain interacts with Rab family small GTPases and functions enzymatically as a Rab-specific guanine nucleotide exchange factor (GEF). Human MTMR5 and MTMR13 have GEF activity toward Rab28, a poorly characterized and divergent member of the Rab superfamily <cite>yashimura10</cite>. Drosophila Sbf regulates Rab21, which specifies an endosomal pathway and cortical control. | ||
| + | |||
| + | A coiled-coil domain mediates the interactions of MTMR5 and MTMR13 with MTMR2, which results in the increase of enzymatic activity of MTMR2 <cite>kim03, robinson05</cite>. | ||
===Catalytic activity and functions=== | ===Catalytic activity and functions=== | ||
| − | + | All MTMR5 members are predicted to be catalytically inactive [[pseudophosphatase]]s. Human MTMR5 interacts with MTMR2 (see [[Phosphatase_Subfamily_MTMR1|MTMR1 subfamily]]) via its coiled-coil domain and mutations in the coiled-coil domain of either MTMR2 or MTMR5 abrogate this interaction. Through this interaction, MTMR5 increases the enzymatic activity of MTMR2 and dictates its subcellular localization <cite>kim03</cite>. This is a good example of inactive phosphatase functions as regulator of active phosphatase. | |
| − | Human | + | |
| − | === | + | The interaction between MTMR5 and MTMR1 subfamilies is also observed in Drosophila. In addition, fruit fly Sbf has been reported as a critical coordinator of PI(3)P and Rab21 regulation, which specifies an endosomal pathway and cortical control <cite>jean12</cite>,. |
| − | + | ||
| + | ===Diseases=== | ||
| + | Mice deficient for MTMR5 exhibit male infertility characterized by azoospermia <cite>firestein02</cite>. | ||
| + | |||
| + | Charcot-Marie-Tooth disease type 4B (CMT4B) is a severe, demyelinating peripheral neuropathy caused by mutations in either MTMR13, MTMR5 or their binding partner, MTMR2 <cite>Chen14, robinson05, robinson08, nakhro13</cite>. In addition, loss of Mtmr13 in mice leads to a peripheral neuropathy with many of the key features of CMT4B. | ||
===References=== | ===References=== | ||
<biblio> | <biblio> | ||
| − | # | + | #Chen14 pmid=25462154 |
| − | # | + | #yashimura10 pmid=20937701 |
| − | # | + | #kim03 pmid=12668758 |
| − | # | + | #robinson05 pmid=15998640 |
| + | #robinson08 pmid=18349142 | ||
| + | #firestein02 pmid=11994405 | ||
| + | #nakhro13 pmid=23749797 | ||
| + | #jean12 pmid=22648168 | ||
</biblio> | </biblio> | ||
| + | |||
| + | === Technical notes === | ||
| + | ===== C1 domain lost in vertebrates ===== | ||
| + | We noticed that sea urchin, Drosophila melanogaster, C. elegans, and sponge have a C1 domain adjacent to C-terminal PH domain. To study the presence and absence of C1 domain in MTMR5 subfamily, we carried out the following analyses: | ||
| + | # We searched the presence of C1 domain in MTMR5 orthologs in [http://resdev.gene.com/gOrtholog/view/cluster/MC0003324/sequence/fasta internal orthology database]. The C1 domain is present in most metazoa except vertebrates. Among three chordates in internal orthology database, lancet has the typical domain combination, but the two Ciona genomes do not contain the C1 domain. Nematostella has a very weak-scoring PH domain due to poor gene prediction - the homologous sequence from the Cnidarian Exaiptasia pallida (gb|KXJ12124.1|) fills in a gap in the gene model and encodes a strong C1 domain, indicating that it is also present in Nematostella | ||
| + | # We searched the C1 domain against protein NR dataset of human and vertebrates. We obtained the C1 domain sequence from D. melanogaster based upon its alignment to Pfam C1_1 domain (see below). Then, BLAST the sequence against human protein NR dataset. The best hit is from PKC, followed by the hits from other proteins involved in cell signaling. But, neither human MTMR5 or MTMR13 is among the hits (E-value threshold e<sup>-5</sup>. We then searched against chordates NR dataset, and did not find MTMR5 and MTMR13, either. | ||
| + | # We then searched the full sequence of C1-containing MTMR5, the Drosophila melanogaster Sbf against protein NR dataset against vertebrates, and then investigated the conserved domain among the top hits. We did not find C1 domain among the top hits in chordates. We looked into the region of C1 domain in the alignment. We found it is either badly aligned with many gaps and very low number of identical residues, or did not align at all. | ||
| + | |||
| + | Here is the sequence of C1 domain of Drosophila melanogaster: | ||
| + | HRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSMKNCT | ||
Latest revision as of 18:25, 14 March 2017
Phosphatase Classification: Fold CC1: Superfamily CC1: Family Myotubularin: Subfamily MTMR5 (SBF)
MTMR5 is an inactive phosphatase (pseudophosphatase), which regulates the active phosphatase MTMR2.
Evolution
MTMR5 is found throughout metazoa. It has two human members, MTMR5 (SBF1) and MTMR13 (SBF2), and single members in Drosophila (Sbf) and C. elegans (mtm-5).
Domain structure
The MTMR5s of most metazoa except chordates have a domain combination of DENN, GRAM, phosphatase, coiled coil, C1 and PH. Vertebrate MTMR5s lost C1 domain (see technical notes below).
The DENN domain interacts with Rab family small GTPases and functions enzymatically as a Rab-specific guanine nucleotide exchange factor (GEF). Human MTMR5 and MTMR13 have GEF activity toward Rab28, a poorly characterized and divergent member of the Rab superfamily [1]. Drosophila Sbf regulates Rab21, which specifies an endosomal pathway and cortical control.
A coiled-coil domain mediates the interactions of MTMR5 and MTMR13 with MTMR2, which results in the increase of enzymatic activity of MTMR2 [2, 3].
Catalytic activity and functions
All MTMR5 members are predicted to be catalytically inactive pseudophosphatases. Human MTMR5 interacts with MTMR2 (see MTMR1 subfamily) via its coiled-coil domain and mutations in the coiled-coil domain of either MTMR2 or MTMR5 abrogate this interaction. Through this interaction, MTMR5 increases the enzymatic activity of MTMR2 and dictates its subcellular localization [2]. This is a good example of inactive phosphatase functions as regulator of active phosphatase.
The interaction between MTMR5 and MTMR1 subfamilies is also observed in Drosophila. In addition, fruit fly Sbf has been reported as a critical coordinator of PI(3)P and Rab21 regulation, which specifies an endosomal pathway and cortical control [4],.
Diseases
Mice deficient for MTMR5 exhibit male infertility characterized by azoospermia [5].
Charcot-Marie-Tooth disease type 4B (CMT4B) is a severe, demyelinating peripheral neuropathy caused by mutations in either MTMR13, MTMR5 or their binding partner, MTMR2 [3, 6, 7, 8]. In addition, loss of Mtmr13 in mice leads to a peripheral neuropathy with many of the key features of CMT4B.
References
Error fetching PMID 20937701:
Error fetching PMID 12668758:
Error fetching PMID 15998640:
Error fetching PMID 18349142:
Error fetching PMID 11994405:
Error fetching PMID 23749797:
Error fetching PMID 22648168:
- Error fetching PMID 20937701:
- Error fetching PMID 12668758:
- Error fetching PMID 15998640:
- Error fetching PMID 22648168:
- Error fetching PMID 11994405:
- Error fetching PMID 25462154:
- Error fetching PMID 18349142:
- Error fetching PMID 23749797:
Technical notes
C1 domain lost in vertebrates
We noticed that sea urchin, Drosophila melanogaster, C. elegans, and sponge have a C1 domain adjacent to C-terminal PH domain. To study the presence and absence of C1 domain in MTMR5 subfamily, we carried out the following analyses:
- We searched the presence of C1 domain in MTMR5 orthologs in internal orthology database. The C1 domain is present in most metazoa except vertebrates. Among three chordates in internal orthology database, lancet has the typical domain combination, but the two Ciona genomes do not contain the C1 domain. Nematostella has a very weak-scoring PH domain due to poor gene prediction - the homologous sequence from the Cnidarian Exaiptasia pallida (gb|KXJ12124.1|) fills in a gap in the gene model and encodes a strong C1 domain, indicating that it is also present in Nematostella
- We searched the C1 domain against protein NR dataset of human and vertebrates. We obtained the C1 domain sequence from D. melanogaster based upon its alignment to Pfam C1_1 domain (see below). Then, BLAST the sequence against human protein NR dataset. The best hit is from PKC, followed by the hits from other proteins involved in cell signaling. But, neither human MTMR5 or MTMR13 is among the hits (E-value threshold e-5. We then searched against chordates NR dataset, and did not find MTMR5 and MTMR13, either.
- We then searched the full sequence of C1-containing MTMR5, the Drosophila melanogaster Sbf against protein NR dataset against vertebrates, and then investigated the conserved domain among the top hits. We did not find C1 domain among the top hits in chordates. We looked into the region of C1 domain in the alignment. We found it is either badly aligned with many gaps and very low number of identical residues, or did not align at all.
Here is the sequence of C1 domain of Drosophila melanogaster:
HRFEKHPYTTPTNCNHCTKLLWGPVGYRCMDCGNSYHEKCTEHSMKNCT