Gene PTPRD-44 in Amphimedon queenslandica

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold CC1
Superfamily CC1
Family PTP
Subfamily PTPRD
Protein sequence
ID Type Fasta BLAST phosphatome Note
AqueP100_AA protein Get Run
AqueP100_AA_5803-6081 phosphatase_domain Get Run
AqueP100_AA_6093-6358 phosphatase_domain Get Run
Domains
Summary
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_Sponge-PTP8_pd Subfamily Sponge-PTP8 5801-6102 2.9e-141 465.0 In-house 2-305 (305) alignment
Range on Protein: 5801-6102
Range on HMM: 2-305/305.0
LPISLDDLAAHI--ATCYDSNAFEEQFKNLYDEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLEcQTEYINANFVDGYSSSKKFITTQGPMKD
 .|.||||||.|  |..|.....|.|.|.||.||...||||...||| ||||.||..||.|||||. ..|. ...||||..||||...||.|..|||.|.
kiialddlaayikearvysdkgleaqykslyeeeesidvgkkeankaknrlkeitlldddriiltekesld.dsdyinasyvdgykrkkkyivaqgPlkn

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSF
|..||||||..|....|||||||.||||.|||||||.|..|.||||.|.|.|....|..|...|||.|.|.||...|.|..|||||.|||.|||..|||.
tvadfWrliveekvstivmltklveggkdkCrqYWpesktekkefgefsvelksektasdyieRklkisiededkesrtvlqyqltdWPdhGvpqfatsl

MSLYRRVINNWSLSKG-TILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVE
.||..|| .... .|| ..||||||||||||||||||||||..|||.|||.......||..||||||.|||| |||||| |.|.||.|.| ..|....|.
lslikrvqkdqkkdkgvpllVhCsagvgRtGvfiavdialerlkkEevvdvfevlkqlRskrmkmvqtldqYvflhdaldelitcgdtsiigsnlrarvn

RLKKN
.|||.
klkkm

subfamily_PTPRD_pd Subfamily PTPRD 5802-6209 1.6e-134 444.6 In-house 4-416 (564) alignment
Range on Protein: 5802-6209
Range on HMM: 4-416/564.0
PISLDDLAAHIATCY--DSNAFEEQFKNLYDE-EKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLeCQTEYINANFVDGYSSSKKFITTQGPMKD
||. ..|..|.|     ..  |||..|..  . . .... . ..||| ||..||. || .|..|...     ...||||.|.||| ..|..| ||||...
pipvaelkehvaklkansdlkfeeeykkieegqqftweaankpaNkaKNRyanivaYdhsRVvLskvegd.egsDYINAsfidgyrkrkayIAtqgPlae

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNStSeVKEFGPFNVILQNTQTYPDLFIRKLSItIQDESSDSHTLIQYQLTSWPDQGVPDYATSF
|. ||||..|...  .|||||||.| || || .|||.. .  ...| . | |...... |  ||....  . .||.|..  |.. |||||.|||..|||.
tiedFWRmvweqnsstiVmltkleEkgkvkchkYWPek.g.tetygeltVtleeeeeladyeirtfkl.kkkkssesreVrqFhFtsWPdhgvpesatsl

MSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVER
..| |.| . ..  .| |.|||||||||||.||..|. ||..|.||.||| ..|..||.||  |||. .|| |.|.|.|| . ||.||...||.. ....
LdlirkvralnepdagPivVhCSaGVGRTGtfividamlerikeektvDiyqyvkalrkqRnamVqteeQYiFiheailealacgntevesenlkqhlqk

LKKNNRKTNSTKLEAQYNLLYQLTPDP-NDVDCKSAKAHASKNRSNNYLPPDKFIVALK-----ETDGYINASYLNSYRGKNAFILAQSPMENTVRDFWK
|.. ...|..|.||. .. |   .... ..  .   .    |||  | |. ..  | |.     |   |||||||..||.|.||| .|.|..||| |||.
LaeveedtemtgleleFqrLatakeieleefavatkpknkkknrfsnilalescrvvlsairakeesdyinasyleayrekrafiatqaplkntvedfwr

MIVDCKVSVIIMLCGEE
|... .| .|.||.. |
mvweeevkiivmltkle

subfamily_Sponge-PTP8_pd Subfamily Sponge-PTP8 6102-6361 1.8e-110 363.9 In-house 15-287 (305) alignment
Range on Protein: 6102-6361
Range on HMM: 15-287/305.0
NNRKTNSTKLEAQYNLLYQLtPDPNDVDCKSAKAHASKNRSNNYLPPDKFIVALKETDG---YINASYLNSYRGKNAFILAQSPMENTVRDFWKMIVDCK
..|......|||||..||.. ....||..|.|............|..|..|.. ||...   ||||||...|..|...|.||.|..|||.|||..||..|
earvysdkgleaqykslyee.eesidvgkkeankaknrlkeitlldddriiltekeslddsdyinasyvdgykrkkkyivaqgPlkntvadfWrliveek

VSVIIMLC----GEEDCCYQYWIDSMTY----DEFVVKVSSETNASGYIERKLKVSI---DKESRSVLQLQVTDWPQDGVVREPSTILKIIDEVREKQKS
||.|.||.    |..|.|.|||..|.|.    .||.|...||..||.|||||||.||   |||||.|||.|.||||..||.......|..|..|...||.
vstivmltklveggkdkCrqYWpesktekkefgefsvelksektasdyieRklkisiededkesrtvlqyqltdWPdhGvpqfatsllslikrvqkdqkk

GKKGPVVVHCSDTVSRSGVYCSVSIALEQCNAEGVVDVFQVTKALRRSKPGAITTLEQYTSIYDVVDLYLQTTY
.|. |..||||..|.|.||...|.||||....|.|||||.|.|.||........||.||....|..|.......
dkgvpllVhCsagvgRtGvfiavdialerlkkEevvdvfevlkqlRskrmkmvqtldqYvflhdaldelitcgd

subfamily_Sponge-PTP9_pd Subfamily Sponge-PTP9 5806-6085 1.7e-104 343.8 In-house 3-298 (301) alignment
Range on Protein: 5806-6085
Range on HMM: 3-298/301.0
DDLAAHIATCYdSNAFEEQFKNLYD-EEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHL-ECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDF
.|| .| |... || ||||.|.|.. |.|.|.|| |.||||||| |||||||||||||.| ..|  ||.|||||...||||..|||| .||||| |||||
edlgthvaakh.snkfeeqykelkegedksctvglseenkalnrfknitvyddnriilkpkpnldlcqreyinasyidgysekkkfiaaqgpmkktlvdf

WRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESS--------------DSHTLIQYQLTSWPDQ
|||||||.||||||.|.|||| ||||.||||||. | .|||||.| |.|.|.|||  ||.|...||| |.              .|....|.|.|.||..
WrliwqekpvsivmvtnlkegtkskceqywpnseaeseefgpftvtlvneqvyPdfvirqlnvkiqdgsnngyierkfkvksdksswdvlqlqvtdWpqd

GV-PDYATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKT
|| ....|  ...   .. ... ..| ..||||..|.|.||...|.|.|||.| | |||. ......|......|. |.|| ...|.. . . . .|
GvvreprtvLqviddvihrqqkigggpvvVHCSdtVsrsGvYcsvsiglEQckaegVVdvfqvtkavrrskpgaVtTLeqytsiydvidmylqlnst

subfamily_Sponge-PTP9_pd Subfamily Sponge-PTP9 6098-6359 2.2e-101 333.5 In-house 4-295 (301) alignment
Range on Protein: 6098-6359
Range on HMM: 4-295/301.0
RLKKNNRKTNSTKLEAQYNLLYQLTPDPNDVDCKSAKAHASKNRSNNYLPPDKFIVALKET-----DGYINASYLNSYRGKNAFILAQSPMENTVRDFWK
 |.... ...|.|.|.||. |.. ......| .................. ...|.. |..       ||||||...|. |..|| ||.||..|..|||.
dlgthvaakhsnkfeeqykelkegedksctvglseenkalnrfknitvyddnriilkpkpnldlcqreyinasyidgysekkkfiaaqgpmkktlvdfWr

MIVDCKVSVIIMLCGEEDC----CYQYWIDSMTY----DEFVVKVSSET-----------------NASGYIERKLKVSIDKESRSVLQLQVTDWPQDGV
.|.. |.. |.|.......    |.||| .| .      .| |....|.                    ||||||.||. ||.|..||||||||||||||
liwqekpvsivmvtnlkegtkskceqywpnseaeseefgpftvtlvneqvyPdfvirqlnvkiqdgsnngyierkfkvksdksswdvlqlqvtdWpqdGv

VREPSTILKIIDEVREKQKSGKKGPVVVHCSDTVSRSGVYCSVSIALEQCNAEGVVDVFQVTKALRRSKPGAITTLEQYTSIYDVVDLYLQT
|||| |.|..||.|  .|..  .||||||||||||||||||||||.|||| |||||||||||||.|||||||.||||||||||||.| ||| 
vreprtvLqviddvihrqqkigggpvvVHCSdtVsrsGvYcsvsiglEQckaegVVdvfqvtkavrrskpgaVtTLeqytsiydvidmylql

0050432 (Phosphotyrosine protein) phosphatases II 5799-6086 7.9e-90 296.6 In-house 22-305 (308) alignment
Range on Protein: 5799-6086
Range on HMM: 22-305/308.0
LTLPISLDDLAAHIATCYDSNAFEEQFKNLYDEEKPCD--VGKSNENKALNRLKNITVYDDNRIILtplshlECQTEYINANFVDGY--SSSKKFITTQG
 .|..|..||. ..   .|.  .||.|. |..   ...  |..  ||| .|| |.|  || .|..|      .  . ||||..||||   ...||| |||
sslklsvldllkllekaldlglleeefeellsvkplleysvallpenkdkNrykdilpydhsRVkl......degsdYInAsyvdgyssklprkfIatqg

PMKDTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTS-EVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESsDSHTLIQYQLTSWPDQGVPD
|...|. ||||..|...   ||||||| | |. || ||||...  ...|.|.| | | ......|  .|.| .|  ... .|.|. ... |.|||.|||.
PlpntvedFwrmvweqnvrvIvmLtklvengrekcaqYwplelgggsleygkftvtllseevlddytvrtleltnlgdg.esrtvthfhytnWpdhgvPp

YATSFMSLYRRVINNWslSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTE
...........| .    ..|.|.|||||||||||.|||.|..||| .||. ||. ..|..||.||. |||...|||||..|||| . . .| 
speilldflelvrksl..pggpivVHCsaGvGRtGtfialdllleqlekeggvdvfeavkklReqRpgmvqtpeqylflyralleylklkltk

subfamily_Anemone-PTP-6_pd Subfamily Anemone-PTP-6 5803-6116 5.1e-88 290.2 In-house 2-316 (318) alignment
Range on Protein: 5803-6116
Range on HMM: 2-316/318.0
ISLDDLAAHIATCYDS--NAFEEQFKNLYDEEKPCDVGKSN--ENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKD
||..||. |..    |    ..|....|  .|.     ||.   ||| ||  ||. ||. |. |..|.  | ...|||||..||| ..|..| .|.|. .
isvedleshvrrlresGelllseeyerlsrseetvtslkslepvnkaknryanilaydhtrvkLqmleg.eegsDyinanyidGyrrkkayiaaqaPlpe

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSevKEFGPFNVILQNTQTYPDLFIRKLSITIqDESSDSHTLIQYQLTSWPDQGVPDYATSF
|. ||||..|.     |||||...| || |. .|||.. |  ...|   | |... .. |. .|....|  .|...| .  ||. |||||.|||. ..|.
tieDfWrmvWeqnsavivmltqeeergkakvhryWPskgs..rsygklvvelkeevelsdyvlrefkvtr.teeeesrqvrqyhytsWpdegvpesgasl

MSLYRRVINNW-SLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVE
..| |.| .   . ..|.|.|||||||||||||||||| ||..|.|..||. ..|..||.||  |||  ||| |..|.||| ...|.||.  .. .  ..
ldlvrqvskaqqksgagpivvhCsaGvGrtGvfiavdillerikaealvDvfqtvkqlreqrnlmvqtedqyefiydvllealasgdtevdasdlrsrir

RLKKNNRKTNSTKLEAQYN
.|.... ..  |...|...
elreqdpesgttemdaefq

subfamily_Sponge-PTP11_pd Subfamily Sponge-PTP11 5816-6080 7.3e-88 289.2 In-house 17-283 (290) alignment
Range on Protein: 5816-6080
Range on HMM: 17-283/290.0
YDSNAFEEQFKNLYDEEKP--CDVGKSNENKALNRLKNITVYDDNRIILTPLS-HLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERP
   . |..||| |   |..    || ...|| ||| .|| |||||||.| |.| | .|. ||||| ...||. .|..| ||||...||||||.|||||. 
kgnegfrnqfkmldsgesehtvtvgltssnkllnRfanivvyddnritLrpisghkDCtneyinAcyikgykekkqyiatqgpvsntlvdFWkliwqekv

VSIVMLTKLKEGGKSKCRQYWPNSTSEVkeFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQG-VPDYATSFMSLYRRVINNWSL
  |||||. .| || ||.||||.| ..   .|.|.. |.| .|. .  .|||... .... ......|||.|.|...| |....|. ....... ...  
tiivmltniieegkvkCqqYWpdsdtka..ygefsikllneetlneyierklevknknsagakqsvtqyqitnwdstgkvtnpqtillvieemyktqrkr

SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEI
 .. |.||||..|||..||.|........|.| |.|.  .....|.|....||. .|| .... .|. .
gntsivvHCSdtvgrsavfcaaattinkcktegvidvfqvlksqRiqkpgsvqtvqqyqgifqivltyl

0051299 (Phosphotyrosine protein) phosphatases II 5817-6080 3.4e-87 287.8 In-house 21-286 (288) alignment
Range on Protein: 5817-6080
Range on HMM: 21-286/288.0
DSNAFEEQFKNLYDEE--KPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVS
. . ..|.|. |..     .. ...  ||.  || ..|  ||..|..|..|.  .  . ||||...||| ...||| ||||...|. ||||..|...   
gltglleefeellsllpdltlsaallpenleknRysdilpydhsRVkLsvldg.vegsdYinAsyidgynlkrkfIatqgPlpntvedFWrmvweqnvrv

IVMLTKLKEGGKSKCRQYWPNstSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQD---ESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSL
||||||| | |. || ||||.  ......|.. | | ......|  .|.| .|  |    .. |.| .... |.|||.||||.........|.|..  . 
IvmltklvelgrekcaqYwpl..ggsltygditvtllseevlddytvrtlevtnldlldgdgesrtvthfhytnwpdhgvpdspellldflrlvrkalas

SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEI
..|...|||||||||||.|||.|..||| .||..||. ..|.|||.||. |||...||.|...|||| .
gggpvvVHCsaGvgRtgtfialdllleqlekeggvdvleavkrlreqRpgmvqtpeqyrfvyealleyl

0046845 (Phosphotyrosine protein) phosphatases II 5821-6087 7.5e-87 286.6 In-house 2-281 (284) alignment
Range on Protein: 5821-6087
Range on HMM: 2-281/284.0
FEEQFKNLYDEEK----PCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECQTEYINANFVDGY-----SSSKKFITTQGPMKDTLVDFWRLIWQER
.||.|. |.        ...|..  ||. .|| |.| .||..|..|..|..    ..||||..||||      ..|||| ||||...|. ||||..|...
leeefeellsltvklllslsvallpenlsknRykdilpydhsRVklksldgdledsdYinAsyvdgydldltyikkkfIatqgPlpntvedFwrmvweqn

PVSIVMLTKLKEGGKSKCRQYWPNStSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWS-
   |||||.| | |. || ||||.. .||...|.| | | ......|  .|.|..|  . .. |.|..... |||||.|||..........| | .  . 
vrvIVmltelvengrekcaqYwple.gevltygdftvtllseevkddytvrtleltnlgytgesrtvthfhytswpdhgvppspedlleflrlvrellen

-LSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEK---VVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEI
  ..|.|.|||||||||||.|||.|..||| .||.   .||. ..|.|||.||. |||.|.||.|...|||| . ...| .
lpgggpivVHCsaGvgRtGtfialdllleqlekeglllgvdvleavkrlreqRpgmvqtleqyrfvyealleylklkltll

0036941 (Phosphotyrosine protein) phosphatases II 5820-6091 1.1e-85 282.9 In-house 14-288 (297) alignment
Range on Protein: 5820-6091
Range on HMM: 14-288/297.0
AFEEQFKNLYDEE--KPCDVGKSNENKALNRLKNITVYDDNRIILtplSHleCQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVM
 ....|. |..     ...|... ||. .|| |.|  ||..|..|   ..    . ||||..||||. ..||| ||||...|. ||||..|...  .|||
lllkefeellpllllgslsvallpenleknRykdilpydhtRVkl...dd..egsdYinAsyvdgydlkrkfIatqgPlpntvedFWrmvweqnvtvIvm

LTKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQT--YPDLFIRKLSITIQdESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSL--SK
||.| | |. || ||||. . |....|.| | |.....  ..|  .|.| .|   ....|.|. ... |.||| |||....|.......| .  .|  |.
ltelvelgrekcaqywpleegesltygdftvtllsvevvllddytlrtlevtdt.gngesrtvthfhytgwpdhgvpespaslldfielvrkvlkllpsg

GTILVHCSAGVGRTGVFIAVDIALEQAK---KEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIEN
| .||||||||||.|.|||.|..|.| .   ||. |||  .|. ||.||. .||.|.||.||..|||| . ...| .|. .
gpvlVHCsaGvgRsgtfiaadlmlqqledklkeggvdileavkklReqRpgavqtleqyrflyeallellkkkltkepllk

subfamily_Sponge-PTP10_pd Subfamily Sponge-PTP10 5818-6086 1.3e-85 281.8 In-house 19-284 (287) alignment
Range on Protein: 5818-6086
Range on HMM: 19-284/287.0
SNAFEEQFKNLYD-EEKPCD--VGKSNENKALNRLKNITVYDDNRIILTplshlECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVS
.. |..||. | . .... .  .. ...|| .|||..| |.|..|..|      ... .|||| |.|||...|.|| ...|| .|...||.||.....  
negfknqftvleqvtqredevthniasqnkdknRltqilvpdnyrvllk.....gehpdyinavfidgykekkafiiaesPmfntarnfWkliddrnvta

IVMLTKLKEGGKSKCRQYWPNSTSevKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQG-VPDYATSFMSLYRRVINNWSLSK
||||...||  ...| ||||...|    .|..|. | | ... .  .||| .. .....| ... |||.|.|...| |....|... . ... ..   ..
ivmlcqekendeevcyqyWpeeks..vvlGeyniellneevnagyierklevknknkagdkqqvkqyqitnWdstgkvtepqtillvieemyktqrkrgn

GTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTE
..|.||||..|||...|.|........|.| |.|.  .... |.|....||  .|| |. |..|| . ...| 
tsivvhCsdtvGrsamfcaaattinkckteGviDvfqvlksqriqkpgsvqtveqykfindivleyldsfety

0039614 (Phosphotyrosine protein) phosphatases II 5801-6085 2.6e-85 281.8 In-house 14-294 (297) alignment
Range on Protein: 5801-6085
Range on HMM: 14-294/297.0
LPISLDDLAAHIATCYDSNAFEEQFKNLYDEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECQTEYINANFVDGYSS-SKKFITTQGPMKDT
 |.|  ||. .. .. ... ....|..|..   .. .... ||| .|| |.|  ||..|..|.|. .    . ||||..||||.  ..||| ||||...|
iplsvldlllllekansktllllefeellslkpdysiallpenkdknrykdilpydhsrvklkpedgvdldsdYinAsyvdgydlltrkfIatqgPlpet

LVDFWRLIWQERPVSIVMLTKLKEGGKsKCRQYWPNSTSevkEFGPFNVILQNTQTYPDLFIRKLSITIQDESsdsHTLIQYQLTSWPDQGVPDYATSFM
. ||||..|...  .|||||||.| |. || ||||....   ..|.| | | ....... ..|.|..|  .||   .|. ..| |.||| |||.......
vedFwrmvweqgvtvivmLtklvelgr.kcaqywpeegg...tygdftvtllkvehldgytvrtlevtnnges...rtvthfqytgwpdhgvppslelll

SLYRRVINNWSL--SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKT
.... | .  .   ..| .||||||||||||.||| ...||| .||. ||.  .|..||.||...||...|| ||.||||| . ...|
eflelvrealaelpkggpvlVHCsaGvgRtGtfiaaylmleqlekeggvdvleavkelreqRpgavqtpsqyrflydallellkrklt

0040438 (Phosphotyrosine protein) phosphatases II 5819-6096 4.3e-85 281.1 In-house 18-292 (317) alignment
Range on Protein: 5819-6096
Range on HMM: 18-292/317.0
NAFEEQFKNLYDE--EkPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIV
.|..|.|..|..   . ...|..  ||| .|| ..|  ||..|..|.||.     . ||||..|||.. ..||| ||||...|. ||||..|...  .||
talleefedllslkld.tysvaelpenkdknrypdilpydhsRVkLsplgg.dldsdYInAsyvdgpnlkrkfIatqgPlpntvedFwrmvweqgvtviv

MLTKLKEGGKSKCRQYWPNstSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQdESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTI
|||.|.| |. || ||||.   |....|.| | |........  .|.| ..   ..|.|.|. ... |.|||.|||.. ... .. ..| .. . ..| .
mLteleelgrekcaqYwpl..getltygdftvtllseeelagitlrtlevedl.gdsesrtvthfhytgWpdhgvppspdllldfleavrealedpggpv

LVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAV
||||||||||||.|||....||| .||. ||.  .|..||.||...||...|| ||.||||| . .. | .|. .. |..
lVHCsaGvgRtGtfiaaylmleqlekeggvdveeavkelreqRpgavqtpeqyrflydalleylkrkltlepaselklkl

subfamily_Anemone-PTP-5_pd Subfamily Anemone-PTP-5 5802-6115 1.8e-84 278.6 In-house 4-318 (319) alignment
Range on Protein: 5802-6115
Range on HMM: 4-318/319.0
PISLDDLAAHIATCYD--SNAFEEQFKNLYDE-EKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKD
.| ...|. .. .  .  .. .|..||.|    ..  |  . .|||  || .||  ||  |..|..|     ...||||.|.|||   .||| ||.|...
eievqeLkerlkalastgetllekefkllkeavndtfdsaskeenkkknryqnilaydrtrvvlseldg.vegsdyinasfidgyqerekfiatqaPlen

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNStsEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSF
|. ||||..|.|.   .||||||.| .| |...|||.   ...|.| . | |.. .   |. ||||.. .. .  .. .. ..| |.|||..||..||| 
tiedfWrmvWeeessivvmltklveklkvklkkywpee..nfeeyGrlivtleeeeeledyiirklklnkkssevetRevkhfqyteWpdhdvPekatsl

MSLYRRVINNWSL-SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVE
. |..|. . ..  ..| | ||||||||||| ||..|..||. |.| |.|.  .|.||| ||  |||  .|| |...|||| . .|.||| ...    . 
ldllkrirksrektqsgPivvhCsaGvGRtGtfivldamlervkeegvlDvfstvsrlRtqRnimvqrpeqYkfiyealleaveagdteievqdlrdrlk

RLKKNNRKTNSTKLEAQY
.|.... .|  |.|| ..
qlaekvadtgetgleref

subfamily_PTPRK_pd Subfamily PTPRK 5804-6115 1.4e-83 275.3 In-house 5-312 (314) alignment
Range on Protein: 5804-6115
Range on HMM: 5-312/314.0
SLDDLAAHIATCY--DSNAFEEQFKNLYDEekpCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLV
  .||  .||.    ..  | |....|..     |. | .||.. || ..|  ||  |..|...   . ...||||...|.|  ...|| ||||...|. 
rvadllqsiallkraegygfkeeyeslfeg...wdaakkdenreknrsgdilaydrsrvflitidg.dpssdyinaalidsykrpaafivtqgPlqetvk

DFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEvkeFGPFNVILQNTQTYPDLFIRKLSITI-QDESSDSHTLIQYQLTSWPDQGVPDYATSFMS
|||||...|.  ||||||.|.| |. || .|||. |.    .|...| | .|..  .| .| ....  .   .. ... |.| ..||| .|| .||....
dfWrlvydencasivmltelvevgrvkClkyWPedtev...ygdikvelvetellaelvvrifrveklargqeeirevrqfqflgWpdhdvPvsatgllk

LYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVERLK
| ||| .    ..| |.|||||| ||||.|||.|| |. ...|.|||.  .|  ||.... ||.  .|| |..|..||  .||.| ||. ..  .    .
lvrrvkksqeeeaGrivvhCsaGaGrtGtfiaidivldmieregvvdvfnavktlrsrkvnmveteeqykfiydvileaclcgetaipvsefkalylesi

KNNRKTNSTKLEAQY
. . .|||..|. ..
rldpqtnssqlkeef

DSPc_SM00195 5821-6080 8.6e-83 273.0 In-house 2-262 (263) alignment
Range on Protein: 5821-6080
Range on HMM: 2-262/263.0
FEEQFKNLYDEE--KPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLeCQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVML
..|.|..| ...  |... .. ..||. || ||| .||..|..|..  .   ...|||||...|....||.| ||||...|. ||||..|.|.   ||||
lkeefekleestspketteaekkknksknRyknilpydhtrVklkkeekk.egsdYINAnyikgankkkkyIatQgPlpstvedFWrmvweekvkiivml

TKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYP-DLFIRKLSITIQDEsSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTIL
|. .| || || .|||..  . ..|| ..| |....... .. .|.|..| ... ...... ||| ..|||.|||| ..|...|.| | .  | |.|.|.
teeeengkekcdrywpeesggketfgkisvklvevekkkdeiilrtleltkegk.eetrkvtqyqyknWpdhgvpdstksvlellravkkskstssgpiv

VHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEI
|||||||||||.|...||.|.. ..|| |||  ||..||.||..|||.|.||||...|.|| |
VhCsaGvgRtgtfvtidiilskleeekkvdifeivkelRkqRpgmvqtleqYlfiyeaileyi

PTPc_SM00194 5821-6080 8.6e-83 273.0 In-house 2-262 (263) alignment
Range on Protein: 5821-6080
Range on HMM: 2-262/263.0
FEEQFKNLYDEE--KPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLeCQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVML
..|.|..| ...  |... .. ..||. || ||| .||..|..|..  .   ...|||||...|....||.| ||||...|. ||||..|.|.   ||||
lkeefekleestspketteaekkknksknRyknilpydhtrVklkkeekk.egsdYINAnyikgankkkkyIatQgPlpstvedFWrmvweekvkiivml

TKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYP-DLFIRKLSITIQDEsSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTIL
|. .| || || .|||..  . ..|| ..| |....... .. .|.|..| ... ...... ||| ..|||.|||| ..|...|.| | .  | |.|.|.
teeeengkekcdrywpeesggketfgkisvklvevekkkdeiilrtleltkegk.eetrkvtqyqyknWpdhgvpdstksvlellravkkskstssgpiv

VHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEI
|||||||||||.|...||.|.. ..|| |||  ||..||.||..|||.|.||||...|.|| |
VhCsaGvgRtgtfvtidiilskleeekkvdifeivkelRkqRpgmvqtleqYlfiyeaileyi

subfamily_PTPRB_pd Subfamily PTPRB 5801-6080 1.8e-82 271.7 In-house 5-285 (293) alignment
Range on Protein: 5801-6080
Range on HMM: 5-285/293.0
LPISLDDLAAHIATCY-DSN-AFEEQFKNLY--DEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPM
 ||.|.....|...   ||.  | |....|   .... ... ....|.| || .||  || .|. |..|.. | ...|||||...||.| ..||.||||.
kpiklekfeehvkkmkadsdlrfseeyeelkavgkdqavkaaelavnraknrytnilpydhsrvkLaalkd.esgsDYinanyipgynsprefiatqGPl

KDTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVkEFGPFNVILQNTQTYPDLFIRKLSITIqdeSSDSHTLIQYQLTSWPDQGVPDYAT
 .|. ||||..|...   |||||.| |.|| || .|||. ...|  .|  .| |...... |  ||.|.|.    ....... ||. ||||| |||. ..
petvddfWrmvwekkssiivmltqlvekgkvkCeeYWPadeepv.lyGdikvtlvaeeeledwvirelkiek...ekeerkvrqyhftsWpdhgvPektk

SFMSLYRRVINNW--SLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEI
..... |.| ..   . ||. |.|||||||||||.|||.|  |.. ..| .|||.||| .||..|. .||. .||.|.|...|. .
tlldfvrtvreaiektaskrPivvhCsaGvGRtGtfialdrllqaieeedyvdifgivaelReeRnllvqtekqYifihqcvldll

0047943 (Phosphotyrosine protein) phosphatases II 5817-6078 3.8e-82 271.1 In-house 10-270 (273) alignment
Range on Protein: 5817-6078
Range on HMM: 10-270/273.0
DSNAFEEQFKNLYDEE--KPCDVGKSNENKALNRLKNITVYDDNRIILtplshLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVS
... ..|.|. |..     .. |..  ||| .|| |.|  ||..|..|      .  . ||||..|||| ...||| ||||...|. ||||..|...   
gltllleefelllslkplltysvallpenkdknrykdilpydhsrvkl.....gdggsdyinAsyvdgynlkrkfiatqgPlpntvedfwrmvweqnvrv

IVMLTKLKEGGKSKCRQYWPNSTSE-VKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSdSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSL--
|||||.| | |. || ||||..  | ....|.| | | ...|..|  .|.| .|  . .  |.| .... |.|||.|||.. .|...... | .  .   
iVmLtelvelgrekcaqYwpleggelsltygkftvtllseetkddytvrtleltnlgtge.srtvthfhytgwpdhgvppslesllefielvrkalealp

SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLE
|.|...|||||||||||.|||.|..|.| .||. ||.  .|..||.||. |||...||.||..||||
sngpvvVHCsaGvgRtgtfialdllldqlekeggvdvleavkllrsqRpgmvqtpeqyrflyealle

0045450 (Phosphotyrosine protein) phosphatases II 5818-6079 4.8e-82 271.4 In-house 26-303 (307) alignment
Range on Protein: 5818-6079
Range on HMM: 26-303/307.0
SNAFEEQFKNLYDEEK----PCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECQTEYINANFV--------DGYSSSKKFITTQGPMKDTLVDFWR
 . ....|. |.....    ....... ||| .|| |.|  ||..|..|..|..    . ||||..|        ||| ...||| ||||...|. ||||
ltgllkefekllsvtvfllgeysiallpenkdknrykdilpydhtRVklssldgsledsdYiNAsyvrvpllllldgydlkrkfIatqgPlpetvedFwr

LIWQERPVSIVMLTKLKEGGKSKCRQYWPNStSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRV
..|...   |||||.|.| |. || ||||.. .|....|.| | | ........ .|.| .|  |... |.|..... |.|||.|||..  .. .....|
mlweqgvtvivmltelvelgrekcaqywPde.geeltygnftvtllseehldgytvrtlevtdldgtgesrtvthfhytgwpdhgvppsfeelldfieev

INNWSL--SKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKV---VDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEE
 .  .   ..| .||||||||||||.||| ...|.| .||..   ||.  .|..||.||...||...|| ||..|||| 
rkaleelpkggpvlVHCsaGvgRtGtfiaaylmlrqlekegtlldvdlleavkllreqRpgavqnpeqyrflyeallel

subfamily_Urchin-PTP-7_pd Subfamily Urchin-PTP-7 5802-6115 3.8e-81 267.4 In-house 5-314 (315) alignment
Range on Protein: 5802-6115
Range on HMM: 5-314/315.0
PISLDDLAAHIATCYD--SNAFEEQFKNLYD-EEKPCDVGKSNENKALNRLKNITVYDDNRIILtPLSHLECQTEYINANFVDGYSSSKKFITTQGPMKD
|| ||.| ...|       | |.......   . .| || |  |||  ||  ||  ||  |. | ||   . ...|.||||.|||.  ...|..|||   
pipldqlityvaqkkastkngfkqdyesipggqlhpldvakkienkqknryiniiaydksrvql.pllendphsdyvnanfidGynkkrryiaaqgpnva

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNStsEVkEFGPFNVILQNTQTYPDLFIRKLSITIQDEssdSHTLIQYQLTSWPDQGVPDYATSF
.. |||||...|    |||||.| || |.|. .|||.   .|  .|.. | ... . . .. .| ||.. .|.    ....|...||||| ||| |....
svkdfwrlvfeedigkivmltnlvegekrkaekywpdk..kv.iyGkitvtrkseevnteytvrtlsvvfgdn...irevvqlhytswpdmgvpkytipl

MSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVER
| |.|.|      | |.|.||||||||||| ||..|  |.||. |...|.  .....||.|.||||...|| |..||||| ..|| | |  . |    . 
mnlirtvkqhhtnsvgaivvhcsaGvGrtGtfitldavldqaeaenaidvynfitgvrqnrikmvqvaeqyqfiydalletfvcgdtsiaqdlylqryds

LKKNNRKTNSTKLEAQY
|   .  | || |. |.
llapspdtgstllqeqf

subfamily_Anemone-PTP-2_pd Subfamily Anemone-PTP-2 5819-6087 4.8e-80 264.0 In-house 27-297 (298) alignment
Range on Protein: 5819-6087
Range on HMM: 27-297/298.0
NAFEEQFKNLYDEEK-----PCDVGKSNENKALNRLKNITVYDDNRIILTPLShLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPV
  ....|..|   ..       .|....|||  ||  .|  .|  |..|.  .  . ...|||| |...|. .. ||.||.|.. |..||||....|   
tgyalefqrlnsvsseieeeekevarkpenkkkNRyadiialdssRvvLeked.adeesdYiNAsflhaykgrnafiatqaPltetvedFWrmvteedig

SIVMLTKLKEGGKSKCRQYWPNSTSEvkEFGPFNVILQNTQTYPDLFIRKLSITIQDESsDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINnWSLSK
.|||||.|.| .| |. .|||.. .|  ..| ..| |...... || .||| .. ..|. ..... | . |||||.||| .||| . | |.|   .    
tiVmltnleeldktkyhkywPdegke..tygeitvsllskeefadlivrklkvskkkee.kerevrqlhftsWpdkgvpenatsvldllrkvra.sqqqa

G--TILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEI
|   ..|.|||||||.| |||.|  ||..|||.|||.  .|..||..|...||. .|| |...| || . ....||
gnkpvivqCsaGvgRsGtfiaidsvlervkkeqvvDvfqvvkvlRkkrpgavqteeqYvfiyeavlealdsfndei

subfamily_Ptp69D_pd Subfamily Ptp69D 5803-6099 3e-79 261.3 In-house 4-305 (307) alignment
Range on Protein: 5803-6099
Range on HMM: 4-305/307.0
ISLDDLAAHIATCYDSN--AFEEQFKNLY--DEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLEcQTEYINANFVDGYSSSKKFITTQGPMKD
|..|||.  . .        ... ...|     .| . |.. .||.  || ..|. .|..|..|...   | ...||||.|. ||  .||||. |.|.  
iaiddleealksrkrdtdfglakeyekLeareidkstkvsekkenalknRyedikafDktRvkLkkingke.dsdYinasfikgykekkkfiaaqdPvea

TLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNStsEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDESS----DSHTLIQYQLTSWPDQGVPDY
|. ||||.|..     ||||..|.|  . || .|||.   . ...|  .| | .... .|  ||.|... ..|.|    ||. ..||. |.|.|  ||. 
tigDfWRmiaeqevtlivmlsnlteknrkkcakYWpie..devqygdilvklvseekhsdyiiReldvskkkeesgevedsrkvvqyhytgWkDskvPev

ATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSL
|.. . | ..| .  .|... |.|||||||||.|.|.|.|. |.| |.|. |||  .|  ||.||  .||||.|| ||. |||. .  |.|.. ..... 
argllklieqvrelyklnrsPivvhCsaGvgrsgifvaldsllqqlkaedkvdifetvkdLrsqRnllvqsleqYvflyralldyssygdtdedvddled

AVERL
|.|||
aierl

0043336 (Phosphotyrosine protein) phosphatases II 5819-6078 1.3e-78 259.6 In-house 20-275 (278) alignment
Range on Protein: 5819-6078
Range on HMM: 20-275/278.0
NAFEEQFKNLYDEE-KPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVM
 .....|..|..    ....... ||| .|| |.|  || .|..|..|.  .  . ||||..||||. ..||| ||||...|. ||||..|...  .|||
tllllefeellsfkldtysiallpenkdknrykdilpydhsrvklsllgg.dldsdYinAsyvdgynvprkfiatqgPlpetvedFwrmvwelgvttivm

LTKLKEGGKSKCRQYWPnstSEVKEFGPFNVILQNTQTYPDLFIRKLSITIqDESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTIL
||.|.| |. || ||||   ......|.| | |.......|  .|.| .|    .. |.|  .|. ..|||.|||.  .........|..  . |.| .|
LtelvelgrvkcaqYwp...ggsltygdftvtllkeehlddytvrtlevtn.lgdgesrtvthyhylgwpdhgvpeslsllldflkavrealedsngpvl

VHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLE
|||||||||||.|||....|||..||. ||.  .|..||.||...||...|| ||..||||
VHCsaGvgRTGtfialyllleqlekeggvdleeavkelreqRpgavqtpsqyrflyealle

subfamily_Urchin-PTPRB-like_pd Subfamily Urchin-PTPRB-like 5817-6078 1.9e-78 258.4 In-house 19-277 (288) alignment
Range on Protein: 5817-6078
Range on HMM: 19-277/288.0
DSNAFEEQFKNL--YDEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVS
. . |.|....|   ...|  ..|.  .|.  || .||  || .|. |. | . | ...||||...||. ..||.|.||||. ||. |||.|.....   
nrtgfseeynsLaalektksvtagrlavnakknRyrnilpyDekrvklkklee.eagaDYinasyidgekkkkkyiatqgPladtvndfWelvyenktst

IVMLTKLKEGGKSKCRQYWPNSTsEVKEFGPFNVILQNTQTYPDLFIRKLSITiqdESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKG
|||||.| ||||.|| .|||..  . |..| ..|.|.....  |   ||| .     . .  .. ||| ..|||.|||. .. .. | | | .. .   |
ivmltelveggktkCeeYWPdad.kpknyGsvtvtlveskeledfvlrkllle...kkkteleitqyqylaWpdhgvPeskapllellrqvkvanqadtg

TILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLE
 |.|||||||||||.|||.| .... ..|...|.||.|..||.||. .|| | || |....||.
piivhCsaGvGrtgtFialdalidaveeedyiDvagtvaklRkqRallvqtlkqYefiyevlls

subfamily_PTPRG_pd Subfamily PTPRG 5804-6090 3.8e-78 258.1 In-house 2-297 (563) alignment
Range on Protein: 5804-6090
Range on HMM: 2-297/563.0
SLDDLAAHIATCYDSN--AFEEQFK----NLYDEEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECQTEYINANFVDGYSSSKKFITTQGPMK
 ....| |.| .. ..   |.|.|.    .  ... ...  . .|||  ||  ||. ||  |. |.||.  . . .|||||..|||  ||.||.||||.|
pvkefakhvaslhadgdigfseefealqsetiskdldaehsqkpenkrKnRylnivaydrsRvklsplpgkkkklDYinAnyidGyqkskafiatqgplk

DTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNstSEVKEFGPFNVILQNTQTYP-----DLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVP
||. ||||.||...   |||.|.|.| |. || .|||.   |....| ..| |.....        | |..| .  ...  . .. .||. |.|||.|||
dtfddFWrmiWeqnvaiivmitnlvergrrkcdvYWPk..desetygalqvtlieeevlalytvrtlviknlklkkkkqcdteklvrqyhytkWPdhgvP

DYATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIE
....  ..  ..         | |.|||||||||||..|..|  |.| ..|..|.. |.. ..| ||  .||. .||.|||||||| |  ..||.  |
ehslpvLifvkkssaankaeaGPivvHcsaGvgrtGtyivldtllkqiqqenavnvfgflkhiraqRnflvqteEqYiflhdalleaiasketellae

subfamily_Sponge-PTP10_pd Subfamily Sponge-PTP10 6096-6359 4.6e-78 257.1 In-house 7-280 (287) alignment
Range on Protein: 6096-6359
Range on HMM: 7-280/287.0
VERLKKNNRKTNSTKLEAQYNLLYQLTPDPNDVDCKSAKAHASKNRSNNYLPPDKFIVALKE-TDGYINASYLNSYRGKNAFILAQSPMENTVRDFWKMI
. .. .........  . |. .| |.| ....|  . |.    |||... |.||.. | ||.  . ||||.....|. |.|||.|.||| ||.|.|||.|
fgefvakghakgnegfknqftvleqvtqredevthniasqnkdknRltqilvpdnyrvllkgehpdyinavfidgykekkafiiaesPmfntarnfWkli

VDCKVSVIIMLCG----EEDCCYQYWIDSM--TYDEFVVKVSSETNASGYIERKLKVSIDK---ESRSVLQLQVTDWPQDGVVREPSTILKIIDEVREKQ
 | .|..|.|||     .|. ||||| ..   .. |. ... .|.  .|||||||.|  ..   . ..| | |.|.|.. | | || ||| .|.|   .|
ddrnvtaivmlcqekendeevcyqyWpeeksvvlGeyniellneevnagyierklevknknkagdkqqvkqyqitnWdstgkvtepqtillvieemyktq

KSGKKGPVVVHCSDTVSRSGVYCSVSIALEQCNAEGVVDVFQVTKALRRSKPGAITTLEQYTSIYDVVDLYLQT
.   ....|||||||| ||...|.. .....|. |||.||||| |  |  |||.. | |||. |.|.|  ||..
rkrgntsivvhCsdtvGrsamfcaaattinkckteGviDvfqvlksqriqkpgsvqtveqykfindivleylds

subfamily_Urchin-PTP-6_pd Subfamily Urchin-PTP-6 5803-6156 6.7e-77 253.7 In-house 2-354 (515) alignment
Range on Protein: 5803-6156
Range on HMM: 2-354/515.0
ISLDDLAAHIATCYDSNAFEEQFKNLYDE-EKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTLV
. | .. | ..       | |.|..|      |  | . . |   || |||  || .|..|  .   . . .|.|| .. .. . | .|..||| | .. 
lplaqfPafvnknrhttlfseefhdlpgpniypqtvaqeeinfkknryknilPydsvrvklevind.nPhsdyfnasyipsfdndkayiasqgPnkasvd

DFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQDEssdSHTLIQYQLTSWPDQGVPDYATSFMSL
|||||..||..  |.|.|||||| |.|| .|||.  ..  .|| ..| |  ...  .  .||| .. .|.   |.|. |...| |||.|||  ..|.. |
dfWrlvlqenvttiamvtklkegdkikcgkyWPdkpgdsvkfGsikvelvsleactggikrkltvlkgdd...srtvtqfhfteWPdkGvpkhtssllkl

YRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVERLKK
 . |  . .  . ....|||||||||||.|..|  . .||. ..||.  .|. .||.|...||  .|| |...|.||..   .| ||.  ..  .. |. 
ikevkadhgqythpliihcsaGvGrtGvvisidsvvahakttrmvdvfnfvtnirqkrpylvqtqeqyafiygavledllwrntlipvihftdhlqdlhs

NNRKTNSTKLEAQYNLLYQLTPDPNDVDCKSAKAH--ASKNRSNNYLPPDKFIVALK
       .|.  ... |  |.|||   ...|....    |||  | || ..  | | 
sgdgrgrskmtkefqtlkslcpdppasqtrsgrtrdnhpknrygnnlplqrnrvild

subfamily_PTPRA_pd Subfamily PTPRA 5802-6113 8.2e-77 253.3 In-house 13-328 (330) alignment
Range on Protein: 5802-6113
Range on HMM: 13-328/330.0
PISLDDLAAHI--ATCYDSNAFEEQFKNLYD--EEKPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECqTEYINANFVDGYSSSKKFITTQGPMK
|. ...|   |   .. |.. | |.|..|     .  ... . .|||  ||. ||  || .|.||....  |. ..|||| |.|||   .|||..||| .
plpvekleeeirirsaddnklfreefnalPagpiqatlelaskeenkeknrvvnilPydfsrvilsvkeGvee.sdyinasfidGykekdkfiaaqGPke

DTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSevKEFGPFNVILQNTQTYPDLFIRKLSITI-QDES--SDSHTLIQYQLTSWPDQGVPDY
.|. ||||.||. .  .|||||.|||  ..|| ||||.  .    .|  .| .....   |. .||. ..   |..   .|  . |. .||||| |||  
etvedfwrmiweqksativmltelkerkeekcaqywPdeGl..vtyGnirvevedetvlvdytvrkflvqqlpdatrekksrlvrqfhftswPdvGvPfe

ATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSL
.   ..| ..| .    | |.| ||||||||||| ||..|  ||. | |..||. ..|.|||.|| .|||.. || |.. .|||  . | ||. .     
piGmlkllkkvkklnqqsagpivvhcsaGvGrtGtfivldavlervkaerkvdvfefvkrlrlqrpqmvqtdeqyefiykvlleyylygdteldvsslek

AVERLKKNNRKTNSTKLEA
 ...|...  .|. . || 
hlqklynkitgtdkiglee

Y_phosphatase Protein-tyrosine phosphatase 5843-6078 9.5e-77 252.9 Pfam-A 1-235 (235) alignment
Range on Protein: 5843-6078
Range on HMM: 1-235/235.0
NKALNRLKNITVYDDNRIILtplSHLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKE
||  || |.|..||..|. |   .. | ...|||||.|.||...|||| ||||.|.|. ||||..|||.  .|||||.|.| |. || ||||....| ..
nkkknRykdilpydktrvkl...kgsegpsdYInAnyvkgykekkkfIatQgPlkstiedFWrmvwqekvkvivmltsleekgrekcaqYwpeeeeeslt

FGPFNVILQ-NTQ-TYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQA
.| ..| |. ...    .  .|||... ..|.|..... |...|.|||.|||. ..|...| |.| .. . ..| ..|||||||||||.|.|.||.|||.
ygdikvelkekekedekeytlrklelkkkkeesekrevkqlhytnWpdhgvpespkslldlirkvekskeaksgpvvVhCsaGvgRtgtfvaldilleql

KKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLE
..|. ||.  ||..||.||..|||||.|| ||..|.||
eaeeevdvlqivkelRkqRpgmvqsleqYiflykaile

Y_phosphatase Protein-tyrosine phosphatase 5843-6078 9.5e-77 252.9 In-house 1-235 (235) alignment
Range on Protein: 5843-6078
Range on HMM: 1-235/235.0
NKALNRLKNITVYDDNRIILtplSHLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKE
||  || |.|..||..|. |   .. | ...|||||.|.||...|||| ||||.|.|. ||||..|||.  .|||||.|.| |. || ||||....| ..
nkkknRykdilpydktrvkl...kgsegpsdYInAnyvkgykekkkfIatQgPlkstiedFWrmvwqekvkvivmltsleekgrekcaqYwpeeeeeslt

FGPFNVILQ-NTQ-TYPDLFIRKLSITIQDESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQA
.| ..| |. ...    .  .|||... ..|.|..... |...|.|||.|||. ..|...| |.| .. . ..| ..|||||||||||.|.|.||.|||.
ygdikvelkekekedekeytlrklelkkkkeesekrevkqlhytnWpdhgvpespkslldlirkvekskeaksgpvvVhCsaGvgRtgtfvaldilleql

KKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLE
..|. ||.  ||..||.||..|||||.|| ||..|.||
eaeeevdvlqivkelRkqRpgmvqsleqYiflykaile

subfamily_Sponge-PTP11_pd Subfamily Sponge-PTP11 6087-6359 1.6e-75 248.6 In-house 2-285 (290) alignment
Range on Protein: 6087-6359
Range on HMM: 2-285/290.0
IPIENYSLAVErlkkNNRKTNSTKLEAQYNLLYQlTPDPNDVDCKSAKAHASKNRSNNYLPPDKFIVALK----ETD---GYINASYLNSYRGKNAFILA
||.....  |.    |..... .. ..|.. | . .  .. |  . ..    .||..|....| . . |.    . |    ||||.|.. |. |...|..
ipvdkfgefva....nghakgnegfrnqfkmlds.gesehtvtvgltssnkllnRfanivvyddnritLrpisghkDCtneyinAcyikgykekkqyiat

QSPMENTVRDFWKMIVDCKVSVIIMLCG----EEDCCYQYWIDS--MTYDEFVVKVSSETNASGYIERKLKVSIDKE---SRSVLQLQVTDWPQDGVVRE
|.|..||..||||.|.. ||..|.||.     ... |.||| ||   .|.|| .|...|.. ..||||||.|  ...   ..|| |.|.| |...| | .
qgpvsntlvdFWkliwqekvtiivmltniieegkvkCqqYWpdsdtkaygefsikllneetlneyierklevknknsagakqsvtqyqitnwdstgkvtn

PSTILKIIDEVREKQKSGKKGPVVVHCSDTVSRSGVYCSVSIALEQCNAEGVVDVFQVTKALRRSKPGAITTLEQYTSIYDVVDLYLQT
|.||| .| |. ..|.   ....||||||||.||.|.|.. .....|. |||.||||| | .|  ||| ..| .||  |...|  ||..
pqtillvieemyktqrkrgntsivvHCSdtvgrsavfcaaattinkcktegvidvfqvlksqRiqkpgsvqtvqqyqgifqivltylds

0050432 (Phosphotyrosine protein) phosphatases II 6096-6359 1.5e-74 246.5 In-house 29-301 (308) alignment
Range on Protein: 6096-6359
Range on HMM: 29-301/308.0
VERLKKNNRKTNSTKLEAQYNLLYQLTPdPNDVDCKSAKAHASKNRSNNYLPPDKFIVALKETDGYINASYLNSY--RGKNAFILAQSPMENTVRDFWKM
 . ||. ........||.... |....| ... .. . ... .|||. ..|| |.  | |.|...|||||| . |  . ...||..|.|..||| |||.|
ldllkllekaldlglleeefeellsvkp.lleysvallpenkdkNrykdilpydhsRVkldegsdYInAsyvdgyssklprkfIatqgPlpntvedFwrm

IVDCKVSVIIMLCGEEDC----CYQYWI-----DSMTYDEFVVKVSSETNASGYIERKLKVSI--DKESRSVLQLQVTDWPQDGVVREPSTILKIIDEVR
. . .|.||.||. ...     |.|||      .|..|. |.|.. ||.. ..|. |.|...   |.||| | ... |.|| .||  .|. .|.....||
vweqnvrvIvmLtklvengrekcaqYwplelgggsleygkftvtllseevlddytvrtleltnlgdgesrtvthfhytnWpdhgvPpspeilldflelvr

EKQksgKKGPVVVHCSDTVSRSGVYCSVSIALEQCNAEGVVDVFQVTKALRRSKPGAITTLEQYTSIYDVVDLYLQT
...   ..||.|||||. |.|.|... . ..||| ..|| ||||.. | ||. .||...|.|||  .|...  ||..
ksl...pggpivVHCsaGvGRtGtfialdllleqlekeggvdvfeavkklReqRpgmvqtpeqylflyralleylkl

subfamily_Urchin-PTP-1_pd Subfamily Urchin-PTP-1 5802-6116 5.3e-74 243.9 In-house 2-313 (315) alignment
Range on Protein: 5802-6116
Range on HMM: 2-313/315.0
PISLDDLAAHIATCYDSNAFEEQFKNLYDEE-KPCDVGKSNENKALNRLKNITVYDDNRIILTPLSHlECQTEYINANFVDGYSSSKKFITTQGPMKDTL
|| . .. | .     .  | |.|..| | .  .  |.. ..|   || |||  .| .|..|  .   . . .|||| .. .. . | .|..||| | ..
pipvaqfpafvnknrhtalfseefhdlpdPdiyrqrvaretinfkknryknilPldsarvklevidd.sPdsdyinasyiksvdddkayiasqgPlkasv

VDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYWPNSTSEVKEFGPFNVILQNTQTYPDLFIRKLsitIQDESSDSHTLIQYQLTSWPDQGVPDYATSFMS
 ||||...||.. .|||.||..|| | |||||||.  ..  ||| ..| | ....  |  .|||   .  .| .|.|. |.|.| |||.||.  ..|.. 
ddfwrmvlqekvttivmvtkkqegdkikcrqywPdrkadsvefGsikvellsleadtdgvarkl...vtrkseesrtvtqfqftewPdkGvdkqtssllk

LYRRVINNWSLSKGTILVHCSAGVGRTGVFIAVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICGKTEIPIENYSLAVERLK
| . |  .    . ..|||||||||||||.|..|  ..|.|....||.  .|. ||..|...||. ..| |..||.||..   .| |.. ...  .. |.
likevkadngkkefsllvhcsaGvGrtGvvisidevvaqikrtrsvdvfnfvknlrakrpylvqteeeyafiydavledllwrntlilvihftdhlqdlh

KNNRKTNSTKLEAQYN
 .   .  .|.  ...
tsvdgsgrskmtkefe

0040439 (Phosphotyrosine protein) phosphatases II 5834-6079 3.2e-73 241.7 In-house 2-245 (249) alignment
Range on Protein: 5834-6079
Range on HMM: 2-245/249.0
PCDVGKSNENKALNRLKNITVYDDNRIILTPLSHLECQTeYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVMLTKLKEGGKSKCRQYW
...|..  ||| .|| ..|  || .|..|..|. |..   ||||...||| ....|| ||||...|. ||||..|...  .|||||.|.| |. || |||
eysvallpenkdknrypdilpydhsrvklsilpglflsd.yinAsyidgyyikrrfiatqgPlpetvedfwrmlwelgitvivmLtslvelgrekcaqyw

PNstSEVKEFGPFNVILQNTQTYPDLFIRKLSITIQdESSDSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSL--SKGTILVHCSAGVGRTGVFI
|.  ....|.| | | | ......|. .|.| .|   . ..|.|  ..| |.|||.|||..  ........| .  .   ..| .||||||||||||.||
pl..ggsleygdftvtllsvevkddytvrtleltnl.ydgesrtvlhiqytdwpdhgvppsfedlldfieavrkaleelpkggpvlVHCsaGvgRtGtfi

AVDIALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEE
| ...||| .||. ||.  .|. ||.||...||...|| ||..|||| 
aaylmleqlekelgvdleeavkllrsqRpgavqnpeqyrflyeallel

subfamily_Nvec-PTP-2_pd Subfamily Nvec-PTP-2 5836-6092 3.2e-73 241.0 In-house 2-248 (250) alignment
Range on Protein: 5836-6092
Range on HMM: 2-248/250.0
DVGKSNENKALNRLKNITVYDDNRIILTPLShLECQTEYINANFVDGYSSSKKFITTQGPMKDTLVDFWRLIWQERPVSIVMLTKLKEGGKSkCRQYWPN
.|.|  .||  ||  .|  .|  |..| . .  . ...|||| |..||. .| ||.||||...|..||||....|   .|||||.||| .|  . |||| 
svakkpqnkeknryadiialdssrvvLekek.gdkesdyinasflhgyderkafiatqgPlqatiedfWrmvleeksgtivmLtnLkesekt.yhqywPv

STSevKEFGPFNVILQNTQTYPDLFIRKLSITIQDESSdSHTLIQYQLTSWPDQGVPDYATSFMSLYRRVINNWSL-SKGTILVHCSAGVGRTGVFIAVD
 ..  ...|   | | ..... |. .||| .. . ... . .. |.. ..|||.|||..||. . | ..|  .     .. ..|.|||||||.| |||.|
eka..ekyGdvtvsllskeefadytkrklklskakkad.erivrqlhfvvWPdkgvPevatavLellkkvqasqqqagnaPvivqCsaGvgrsGafiaid

IALEQAKKEKVVDIAGIVNRLRQQRMKMVQSLDQYLFLHDALLEEIICgkteipIENY
  ||..|||||||.  ....||..|...|.||.|| |.. ..|. . .      .|.|
avlerlkkekvvdvfkvikvlrkdrphavesleqyvfvyeiilkalds......vedy

0045098 (Phosphotyrosine protein) phosphatases II 5833-6083 1.3e-72 239.9 In-house 23-275 (278) alignment