Gene CG2680 in Drosophila melanogaster

Synonym: Dmel\CG2680, EG:100G10.4, Phos2680, Dmel_CG2680, CG2680

Gene expression:

Classification

Phosphatases were first clustered by sequence similarity in the phosphatase domain, and additional information from domains outside of the catalytic domain, from evolutionary conservation, and from known functions was added. The result is a hybrid classification, in which no criterion is universally satisfied, but aims to be of practical use to a range of phosphatase interests. The classification grows as new phosphatomes are sequenced.

Level Class Gene list Wiki page
Fold HAD
Superfamily HAD
Family NagD
Subfamily PGP
Protein sequence
ID Type Fasta BLAST phosphatome Note
DmelP075_AA protein Get Run
DmelP075_AA_22-301 phosphatase_domain Get Run
Domains
Summary
Details
Domain Domain Description Range Significance Score Source Profile Range (length) Alignment
subfamily_PGP_pd Subfamily PGP 25-299 3e-94 306.5 In-house 2-278 (279) alignment
Range on Protein: 25-299
Range on HMM: 2-278/279.0
VISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRKHN
|..|||||.||   .||..  |.||||..||.. ||.|||..|.|....||...|...|.|..|......|..|||..|  ..|| |.. . .|.|....
vlfDcDGVlWlgetaipgaaealnaLkklgKkvlfvtNnstksreellkkfkklgfekvkeeeilssaaaiadyLkqkkfekkvyvlgeeglkeeLkeag

IEFESLQVKEHLTAAS--LVDHLAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENDdCQLIAGGSDVIMPLAENLNVAGFFDFLEHVKRYTQREATFLGK
||. . . ... ....  .|..|...| ||||..... .|||..|.||...|.|.. ....|. .| ..||.......| ............|....|||
iellgtgpeklkdeldedfveelkldkdvgAVvvgvdeklsyakllkAanyLrepe.vlflatneDallplkkevvipgaGslvaaieaasgrkplvlGK

PSPILGEMFGEMFEIrDCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKEDMLNAPV--EAQPDYYADSLADFTQL
|.. | |.. |..|| |..|...|||.| .|..|||.||.|.||||||. ..||. ..    ...||||.|||||...|
Pnelllelllekeei.dpertlmiGDrlktDilfgkncGlqtLlvlsGvtkledveeikkeeklvPdyyldsladllel

Chronophin_1 23-300 6.8e-43 138.0 In-house 2-259 (261) alignment
Range on Protein: 23-300
Range on HMM: 2-259/261.0
DLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRK
.||..|.|||..     .|    ...||| |||.. ||.||| | .|.. ......| ..|... |.  . .  ..|.... . .|| | .    . ||.
qlvLlDldGVlikgeeavpgAaeliealkqagkevlfvtNnsrrtreelaarlkrlGldavaaeeifssalaaaallrqqaakakvyvlGeeglrkelre

HNIEFESLQVKehltaaslvdhlaiekPVGAVLFDIHLDLSYVELAKAIRHLQENddCQLIAGGSDVIMPLAENlNVAGFFDFLEHVKRYTQREATFLGK
  .   . . .                 | ||.  .. .||. .||.||.....   ....|   |. .||.|   . |       |.  ..||... ||
aGlrlvdeped................rveaVvvGydeelsfeklaeaialirdg..alfvatnrDptvPleeG.iaPgtGslaaaveaAsgreplvvGK

PSPILGEMFGEMFEIrDCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKEDMLNAPVEAQPDYYADSLADFTQLL
|.|.. |   | ... | .. . .|| |  |...|. .|...||||.|  ..|.. ... . .||....|.||... |
Pepvmfeealekiga.dpeetvmvGDRldTDilagaraglstllvltGvseleeaqaykkdlrPdavvesiadlleel

Chronophin_2 24-301 3.7e-39 125.7 In-house 2-281 (282) alignment
Range on Protein: 24-301
Range on HMM: 2-281/282.0
LVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHK-PGERVYSLMSLEANETLRK
 |. |||||.|     .. . . |. |. |||.. ||.||| |. |.|..||  .|  .|....|        .||..      .|. . .    . ||.
nvlfdcdgviwngekavagapevvsrlaragknvlfvtnnstrarenyvlkfarlgfadvaaeqifssaycsaaylrdvadvrgkvfviggeglrkelre

HNIEFESLQVKEHltaASLVdHLAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENdDCQLIAGGSDVIMPLAENLNVAGFFDFLEHVKRYTQREATFLGK
  ..      ...   ||.  . | .  | |||     .|... ||||  .|..  || |.|  .|   ||..   . |   .   ..  . |.|| .||
agvpvvedadeqe...asiy.dcaldpdvravlvgydekltflklakacaylrda.dclllatdrdpwhplsdgritpgsgsltaaletasgrkatvigk

PSPILGEMFGEMFEiRDCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKEDML---N----APVEAQPDYYADSLADFTQLLE
||. . |   . |.  |  |...||| |  |. ||. ||....| |.|  . |.     .       .  |||. .|.||. . ||
psrfmfecissqfs.vdparslmigdrletdilfgsncglstvltltgvssleeaqeysdsqlaeqrdlvpdyvvesiadlleale

Hydrolase_6 Haloacid dehalogenase-like hydrolase 25-126 2.3e-26 83.1 Pfam-A 1-101 (101) alignment
Range on Protein: 25-126
Range on HMM: 1-101/101.0
VISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAKnVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRKHN
...|.|||.|     ||.   |..||.||||.. ...||| .|||.|..|....| . |.|...|.. . ...||||.|....|. ... .  | |....
flfDvdGvLwrgdkaipgaaealkalraagkpvvllTNnsskseeeyakkleklgvd.vteeqvvtsataaaeylkkrkadkkvlvigeeglreelkeaG

IE
..
fk

subfamily_LHPP_pd Subfamily LHPP 27-275 9.6e-22 69.0 In-house 3-224 (227) alignment
Range on Protein: 27-275
Range on HMM: 3-224/227.0
SDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEEDYMEKFRHIGAkNVQEDDIVHPVKTIVRYLKKHKPgeRVYSLMSLEANETLRKHNIE
 |  ||..     ||..  |.. |..||....||.|.. .|... .|. ...|  .|.|..|. . . ....|...|   | | |.. ...| . . . .
lDlsGvlhnedaaipgavealkrLrqagvkvrfvtNttkeskralverLirlgf.dveeeeiftsleaarqllrerkl..rpyllveddveedfedidtd

FEslqvkehltaaslvdhlaiekpVGAVLFDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDVIMPLAENlNVAGFFDFLEHVKRYTQREATFLGKPSPI
                           |. .    ..| .| .| | | |... .||| ...  .  ..   . |   | . ..  |. .|. .||||. 
kp......................navviglapesfeyetlnqafrllleakkakliainkgkyykrkdG.lalgpGafvkaleyatgvkaevvGKPsal

LGEMFGEMFeIRDCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKE
. |   | .   | .... ||| . .||.   ..|....|| .|   .|
ffekaleel.gvdpeeavmiGDdvedDveGAlkaGlrgvlVktGkfrpe

Hydrolase_like HAD-hyrolase-like 221-295 1.8e-13 41.5 Pfam-A 3-74 (75) alignment
Range on Protein: 221-295
Range on HMM: 3-74/75.0
GKPSPILGEMFGEMFEIRdCKRCIFIGDTLVQDVQFGKACGFQSLLVLSGCLTKEDMLNapVEAQPDYYADSLAD
|||.| . .   | ....  .... |||.|  |.......| .|.|||.|  ..||.     .|.|||..|.|..
gKPnpgmydkalevlgap.psevvmiGDslatDieaAnnaGirsilVltGvsreedlkl..akakpdyvvddlee

Hydrolase haloacid dehalogenase-like hydrolase 23-261 3.9e-08 25.3 Pfam-A 2-215 (215) alignment
Range on Protein: 23-261
Range on HMM: 2-215/215.0
DLVISDCDGVVWLLVGWI--PNTGAAVNALKAA--------GKQIKFVSNNSFRSEEdyMEKFRHIGAKNV-QEDDIVhpvktivrylkkhkpgervysl
..|..|..|...     .  ... || ....|.        ||...... ..   .   .. |.    . |    |..                      
ktvvfDktGTLtegepsvallgnkaalalaaaletgsehpigkavvaaakanstrgg..ltgfatfigrgvsgkvdgi......................

mSLEANETLRKHNIEFesLQVKEHLTAASLVDHLAIEKP--VGAVLFDIHLDLSYVELAKAIRHLQENdDCQLIAGGSDVIMPLAENLNVAGFFD--FLE
 .|.  |.... ...   .....  .     .. ...    . |.      |  . |.|.|...|.|.  ...    .| . . .   . ||..|  .  
.vlgnpewmtalglrv..iapdlvaaegqskgrtvvvvavqaralgviafadpvkpeaaeavasLkea.Gievvlltgdnpetaeaiakqagiedslvfa

HVKrytqreatflGKPSPILGEMFGEMFEIRDCkRCIFIGDTLvQDVQFGKACG
.|           |||.| | .   | . |    .....||..  |.....|.|
evv..........gkPepklfvaaieeLqidpg.evamvGDgv.nDapalaaAg