User contributions
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
- 20:14, 8 December 2015 (diff | hist) . . (+15) . . Pseudophosphatases (obsolete)
- 20:11, 8 December 2015 (diff | hist) . . (+6) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:36, 7 December 2015 (diff | hist) . . (+100) . . Phosphatase Subfamily DSP3 (→DUSP27) (current)
- 20:00, 7 December 2015 (diff | hist) . . (+389) . . Phosphatase Subfamily DSP3 (→Function)
- 22:50, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP
- 21:08, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP (→References)
- 21:08, 4 December 2015 (diff | hist) . . (+201) . . Phosphatase Family PTP (→Second phosphatase domain (D2))
- 21:02, 4 December 2015 (diff | hist) . . (+383) . . Phosphatase Family PTP
- 00:45, 20 November 2015 (diff | hist) . . (+56) . . Phosphatase Family CDC25 (→Acr2) (current)
- 00:44, 20 November 2015 (diff | hist) . . (+146) . . Phosphatase Family CDC25 (→CDC25/YCH1)
- 00:40, 20 November 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 00:40, 20 November 2015 (diff | hist) . . (+35) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 06:46, 18 November 2015 (diff | hist) . . (+175) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 20:58, 17 November 2015 (diff | hist) . . (+248) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 19:27, 17 November 2015 (diff | hist) . . (+1,180) . . HMM PD0017 (current)
- 19:18, 17 November 2015 (diff | hist) . . (+1,221) . . Phosphatase Family PPM
- 21:34, 16 November 2015 (diff | hist) . . (+189) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure) (current)
- 19:03, 16 November 2015 (diff | hist) . . (+118) . . Phosphatase Family CDC25 (→Acr2)
- 06:35, 16 November 2015 (diff | hist) . . (+1,292) . . Phosphatase Family CDC25
- 02:00, 16 November 2015 (diff | hist) . . (+126) . . Phosphatase Subfamily CDC25 (→Phosphatase domain structure)
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)