User contributions
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
- 20:13, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID AqueP047 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:31, 3 May 2016 (diff | hist) . . (0) . . Phosphatase Family PTP
- 20:22, 29 April 2016 (diff | hist) . . (+81) . . Phosphatase Subfamily PPM1A (→Different functions of PPM1A and PPM1B)
- 20:45, 27 April 2016 (diff | hist) . . (+25) . . Phosphatase Subfamily PTEN (→References)
- 20:44, 27 April 2016 (diff | hist) . . (+175) . . Phosphatase Subfamily PTEN (→Functions)
- 18:28, 22 March 2016 (diff | hist) . . (-1) . . Phosphatase Subfamily PTPRG (→Evolution)
- 19:57, 17 March 2016 (diff | hist) . . (-126) . . Phosphatase Subfamily MTMR14 (→Domain Structure)
- 18:23, 16 March 2016 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 17:16, 16 March 2016 (diff | hist) . . (+78) . . N Phosphatase GeneID SpurP151 (Created page with "Removed. It is redundant to SpurP152. Its sequence is a substring of SpurP152.") (current)
- 00:09, 14 March 2016 (diff | hist) . . (-28) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:28, 12 March 2016 (diff | hist) . . (+119) . . Phosphatase Subfamily PTPN5 RR (→PTPN7 (HePTP/LC-PTP))
- 18:21, 7 March 2016 (diff | hist) . . (+20) . . N Phosphatase GeneID CeleP183 (Created page with "This is a stub page.") (current)
- 18:17, 7 March 2016 (diff | hist) . . (+40) . . N Phosphatase Subfamily Rtr1 (Redirected page to Phosphatase Subfamily RTR1) (current)
- 00:49, 1 March 2016 (diff | hist) . . (-5) . . Phosphatase Subfamily AP
- 01:46, 12 February 2016 (diff | hist) . . (-18) . . Pseudophosphatases (→CC1 fold)
- 23:39, 11 February 2016 (diff | hist) . . (+273) . . Pseudophosphatases (→HP1 family)
- 23:35, 11 February 2016 (diff | hist) . . (+161) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+1) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+628) . . Pseudophosphatases
- 23:19, 11 February 2016 (diff | hist) . . (+43) . . N Pseudophosphatases (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
