User contributions
(newest | oldest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)
- 20:13, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID AqueP047 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:31, 3 May 2016 (diff | hist) . . (0) . . Phosphatase Family PTP
- 20:22, 29 April 2016 (diff | hist) . . (+81) . . Phosphatase Subfamily PPM1A (→Different functions of PPM1A and PPM1B)
- 20:45, 27 April 2016 (diff | hist) . . (+25) . . Phosphatase Subfamily PTEN (→References)
- 20:44, 27 April 2016 (diff | hist) . . (+175) . . Phosphatase Subfamily PTEN (→Functions)
- 18:28, 22 March 2016 (diff | hist) . . (-1) . . Phosphatase Subfamily PTPRG (→Evolution)
- 19:57, 17 March 2016 (diff | hist) . . (-126) . . Phosphatase Subfamily MTMR14 (→Domain Structure)
- 18:23, 16 March 2016 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 17:16, 16 March 2016 (diff | hist) . . (+78) . . N Phosphatase GeneID SpurP151 (Created page with "Removed. It is redundant to SpurP152. Its sequence is a substring of SpurP152.") (current)
- 00:09, 14 March 2016 (diff | hist) . . (-28) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:28, 12 March 2016 (diff | hist) . . (+119) . . Phosphatase Subfamily PTPN5 RR (→PTPN7 (HePTP/LC-PTP))
- 18:21, 7 March 2016 (diff | hist) . . (+20) . . N Phosphatase GeneID CeleP183 (Created page with "This is a stub page.") (current)
- 18:17, 7 March 2016 (diff | hist) . . (+40) . . N Phosphatase Subfamily Rtr1 (Redirected page to Phosphatase Subfamily RTR1) (current)
- 00:49, 1 March 2016 (diff | hist) . . (-5) . . Phosphatase Subfamily AP
- 01:46, 12 February 2016 (diff | hist) . . (-18) . . Pseudophosphatases (→CC1 fold)
- 23:39, 11 February 2016 (diff | hist) . . (+273) . . Pseudophosphatases (→HP1 family)
- 23:35, 11 February 2016 (diff | hist) . . (+161) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+1) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+628) . . Pseudophosphatases
- 23:19, 11 February 2016 (diff | hist) . . (+43) . . N Pseudophosphatases (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
- 20:14, 8 December 2015 (diff | hist) . . (+15) . . Pseudophosphatases (obsolete)
- 20:11, 8 December 2015 (diff | hist) . . (+6) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:36, 7 December 2015 (diff | hist) . . (+100) . . Phosphatase Subfamily DSP3 (→DUSP27) (current)
- 20:00, 7 December 2015 (diff | hist) . . (+389) . . Phosphatase Subfamily DSP3 (→Function)
- 22:50, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP
- 21:08, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP (→References)
- 21:08, 4 December 2015 (diff | hist) . . (+201) . . Phosphatase Family PTP (→Second phosphatase domain (D2))
- 21:02, 4 December 2015 (diff | hist) . . (+383) . . Phosphatase Family PTP
- 00:45, 20 November 2015 (diff | hist) . . (+56) . . Phosphatase Family CDC25 (→Acr2) (current)
- 00:44, 20 November 2015 (diff | hist) . . (+146) . . Phosphatase Family CDC25 (→CDC25/YCH1)
- 00:40, 20 November 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 00:40, 20 November 2015 (diff | hist) . . (+35) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 06:46, 18 November 2015 (diff | hist) . . (+175) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 20:58, 17 November 2015 (diff | hist) . . (+248) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 19:27, 17 November 2015 (diff | hist) . . (+1,180) . . HMM PD0017 (current)
- 19:18, 17 November 2015 (diff | hist) . . (+1,221) . . Phosphatase Family PPM
- 21:34, 16 November 2015 (diff | hist) . . (+189) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure) (current)
- 19:03, 16 November 2015 (diff | hist) . . (+118) . . Phosphatase Family CDC25 (→Acr2)
- 06:35, 16 November 2015 (diff | hist) . . (+1,292) . . Phosphatase Family CDC25
- 02:00, 16 November 2015 (diff | hist) . . (+126) . . Phosphatase Subfamily CDC25 (→Phosphatase domain structure)
- 01:56, 16 November 2015 (diff | hist) . . (+1,014) . . Phosphatase Subfamily CDC25
- 07:36, 15 November 2015 (diff | hist) . . (+11) . . Phosphatase Superfamily CC2
- 07:34, 15 November 2015 (diff | hist) . . (+55) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:32, 15 November 2015 (diff | hist) . . (-22) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:30, 15 November 2015 (diff | hist) . . (+944) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 06:22, 15 November 2015 (diff | hist) . . (+355) . . Phosphatase Superfamily CC2
- 21:22, 13 November 2015 (diff | hist) . . (+1,707) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 21:03, 11 November 2015 (diff | hist) . . (+83) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 20:14, 11 November 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily DSP1
- 20:10, 11 November 2015 (diff | hist) . . (-16) . . Phosphatase Family DSP
- 20:06, 11 November 2015 (diff | hist) . . (+8) . . Phosphatase Family DSP
- 20:05, 11 November 2015 (diff | hist) . . (+17) . . Phosphatase Family DSP
- 20:03, 11 November 2015 (diff | hist) . . (+851) . . Phosphatase Family DSP
- 19:57, 11 November 2015 (diff | hist) . . (+65) . . Phosphatase Fold CC1
- 19:57, 11 November 2015 (diff | hist) . . (-442) . . Phosphatase Fold CC1
- 18:42, 3 November 2015 (diff | hist) . . (+281) . . Phosphatase Subfamily PTPN5 RR (→Domains)
- 21:16, 28 October 2015 (diff | hist) . . (+106) . . Phosphatase Fold CC1 (→Structure)
- 20:43, 28 October 2015 (diff | hist) . . (-40) . . Phosphatase Fold CC1
- 20:42, 28 October 2015 (diff | hist) . . (+217) . . Phosphatase Fold CC1
- 20:38, 28 October 2015 (diff | hist) . . (+778) . . Phosphatase Fold CC1
- 20:25, 28 October 2015 (diff | hist) . . (+92) . . Phosphatase Family Sac (→Phosphatase domain)
- 20:18, 28 October 2015 (diff | hist) . . (+21) . . HMM PD00008 (→References)
- 18:21, 28 October 2015 (diff | hist) . . (+45) . . Phosphatase Family Myotubularin (→References)
- 18:20, 28 October 2015 (diff | hist) . . (+876) . . Phosphatase Family Myotubularin (→Myotubularin phosphatase domain)
- 17:49, 28 October 2015 (diff | hist) . . (0) . . m HMM PD00142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:49, 28 October 2015 (diff | hist) . . (+25) . . N HMM PD0142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:48, 28 October 2015 (diff | hist) . . (+483) . . Phosphatase Family Myotubularin
- 22:15, 26 October 2015 (diff | hist) . . (-2,611) . . HMM PD00142
- 22:13, 26 October 2015 (diff | hist) . . (+122) . . HMM PD00142 (→Obtain phosphatase domain)
- 22:57, 21 October 2015 (diff | hist) . . (+11) . . Phosphatase Family PTP (→Non-receptor PTPs)
(newest | oldest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)