User contributions
(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)
- 20:13, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID AqueP047 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:31, 3 May 2016 (diff | hist) . . (0) . . Phosphatase Family PTP
- 20:22, 29 April 2016 (diff | hist) . . (+81) . . Phosphatase Subfamily PPM1A (→Different functions of PPM1A and PPM1B)
- 20:45, 27 April 2016 (diff | hist) . . (+25) . . Phosphatase Subfamily PTEN (→References)
- 20:44, 27 April 2016 (diff | hist) . . (+175) . . Phosphatase Subfamily PTEN (→Functions)
- 18:28, 22 March 2016 (diff | hist) . . (-1) . . Phosphatase Subfamily PTPRG (→Evolution)
- 19:57, 17 March 2016 (diff | hist) . . (-126) . . Phosphatase Subfamily MTMR14 (→Domain Structure)
- 18:23, 16 March 2016 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 17:16, 16 March 2016 (diff | hist) . . (+78) . . N Phosphatase GeneID SpurP151 (Created page with "Removed. It is redundant to SpurP152. Its sequence is a substring of SpurP152.") (current)
- 00:09, 14 March 2016 (diff | hist) . . (-28) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:28, 12 March 2016 (diff | hist) . . (+119) . . Phosphatase Subfamily PTPN5 RR (→PTPN7 (HePTP/LC-PTP))
- 18:21, 7 March 2016 (diff | hist) . . (+20) . . N Phosphatase GeneID CeleP183 (Created page with "This is a stub page.") (current)
- 18:17, 7 March 2016 (diff | hist) . . (+40) . . N Phosphatase Subfamily Rtr1 (Redirected page to Phosphatase Subfamily RTR1) (current)
- 00:49, 1 March 2016 (diff | hist) . . (-5) . . Phosphatase Subfamily AP
- 01:46, 12 February 2016 (diff | hist) . . (-18) . . Pseudophosphatases (→CC1 fold)
- 23:39, 11 February 2016 (diff | hist) . . (+273) . . Pseudophosphatases (→HP1 family)
- 23:35, 11 February 2016 (diff | hist) . . (+161) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+1) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+628) . . Pseudophosphatases
- 23:19, 11 February 2016 (diff | hist) . . (+43) . . N Pseudophosphatases (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
- 20:14, 8 December 2015 (diff | hist) . . (+15) . . Pseudophosphatases (obsolete)
- 20:11, 8 December 2015 (diff | hist) . . (+6) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:36, 7 December 2015 (diff | hist) . . (+100) . . Phosphatase Subfamily DSP3 (→DUSP27) (current)
- 20:00, 7 December 2015 (diff | hist) . . (+389) . . Phosphatase Subfamily DSP3 (→Function)
- 22:50, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP
- 21:08, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP (→References)
- 21:08, 4 December 2015 (diff | hist) . . (+201) . . Phosphatase Family PTP (→Second phosphatase domain (D2))
- 21:02, 4 December 2015 (diff | hist) . . (+383) . . Phosphatase Family PTP
- 00:45, 20 November 2015 (diff | hist) . . (+56) . . Phosphatase Family CDC25 (→Acr2) (current)
- 00:44, 20 November 2015 (diff | hist) . . (+146) . . Phosphatase Family CDC25 (→CDC25/YCH1)
- 00:40, 20 November 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 00:40, 20 November 2015 (diff | hist) . . (+35) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 06:46, 18 November 2015 (diff | hist) . . (+175) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 20:58, 17 November 2015 (diff | hist) . . (+248) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 19:27, 17 November 2015 (diff | hist) . . (+1,180) . . HMM PD0017 (current)
- 19:18, 17 November 2015 (diff | hist) . . (+1,221) . . Phosphatase Family PPM
- 21:34, 16 November 2015 (diff | hist) . . (+189) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure) (current)
- 19:03, 16 November 2015 (diff | hist) . . (+118) . . Phosphatase Family CDC25 (→Acr2)
- 06:35, 16 November 2015 (diff | hist) . . (+1,292) . . Phosphatase Family CDC25
- 02:00, 16 November 2015 (diff | hist) . . (+126) . . Phosphatase Subfamily CDC25 (→Phosphatase domain structure)
- 01:56, 16 November 2015 (diff | hist) . . (+1,014) . . Phosphatase Subfamily CDC25
- 07:36, 15 November 2015 (diff | hist) . . (+11) . . Phosphatase Superfamily CC2
- 07:34, 15 November 2015 (diff | hist) . . (+55) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:32, 15 November 2015 (diff | hist) . . (-22) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:30, 15 November 2015 (diff | hist) . . (+944) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 06:22, 15 November 2015 (diff | hist) . . (+355) . . Phosphatase Superfamily CC2
- 21:22, 13 November 2015 (diff | hist) . . (+1,707) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 21:03, 11 November 2015 (diff | hist) . . (+83) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 20:14, 11 November 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily DSP1
- 20:10, 11 November 2015 (diff | hist) . . (-16) . . Phosphatase Family DSP
- 20:06, 11 November 2015 (diff | hist) . . (+8) . . Phosphatase Family DSP
- 20:05, 11 November 2015 (diff | hist) . . (+17) . . Phosphatase Family DSP
- 20:03, 11 November 2015 (diff | hist) . . (+851) . . Phosphatase Family DSP
- 19:57, 11 November 2015 (diff | hist) . . (+65) . . Phosphatase Fold CC1
- 19:57, 11 November 2015 (diff | hist) . . (-442) . . Phosphatase Fold CC1
- 18:42, 3 November 2015 (diff | hist) . . (+281) . . Phosphatase Subfamily PTPN5 RR (→Domains)
- 21:16, 28 October 2015 (diff | hist) . . (+106) . . Phosphatase Fold CC1 (→Structure)
- 20:43, 28 October 2015 (diff | hist) . . (-40) . . Phosphatase Fold CC1
- 20:42, 28 October 2015 (diff | hist) . . (+217) . . Phosphatase Fold CC1
- 20:38, 28 October 2015 (diff | hist) . . (+778) . . Phosphatase Fold CC1
- 20:25, 28 October 2015 (diff | hist) . . (+92) . . Phosphatase Family Sac (→Phosphatase domain)
- 20:18, 28 October 2015 (diff | hist) . . (+21) . . HMM PD00008 (→References)
- 18:21, 28 October 2015 (diff | hist) . . (+45) . . Phosphatase Family Myotubularin (→References)
- 18:20, 28 October 2015 (diff | hist) . . (+876) . . Phosphatase Family Myotubularin (→Myotubularin phosphatase domain)
- 17:49, 28 October 2015 (diff | hist) . . (0) . . m HMM PD00142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:49, 28 October 2015 (diff | hist) . . (+25) . . N HMM PD0142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:48, 28 October 2015 (diff | hist) . . (+483) . . Phosphatase Family Myotubularin
- 22:15, 26 October 2015 (diff | hist) . . (-2,611) . . HMM PD00142
- 22:13, 26 October 2015 (diff | hist) . . (+122) . . HMM PD00142 (→Obtain phosphatase domain)
- 22:57, 21 October 2015 (diff | hist) . . (+11) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:41, 20 October 2015 (diff | hist) . . (+123) . . HMM PD00008 (→Description)
- 18:35, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00008 (→Description)
- 18:26, 20 October 2015 (diff | hist) . . (+925) . . Phosphatase Family Sac
- 18:25, 20 October 2015 (diff | hist) . . (+25) . . N HMM PD0008 (Mark moved page HMM PD0008 to HMM PD00008) (current)
- 18:25, 20 October 2015 (diff | hist) . . (0) . . m HMM PD00008 (Mark moved page HMM PD0008 to HMM PD00008)
- 18:20, 20 October 2015 (diff | hist) . . (+395) . . HMM PD00008 (→Description)
- 05:06, 20 October 2015 (diff | hist) . . (+140) . . HMM PD00142 (→How was the HMM built?)
- 05:01, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00142 (→Conserved region of MTMR14)
- 05:00, 20 October 2015 (diff | hist) . . (+44) . . HMM PD00143 (→Conserved region of MTMR14) (current)
- 04:59, 20 October 2015 (diff | hist) . . (+7) . . HMM PD0003 (→How the HMM was built) (current)
- 04:58, 20 October 2015 (diff | hist) . . (+3,887) . . N HMM PD00143 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_MTM_MTMR14_CR '''Name''': MTMR14 conserved regions === Why built the HMM? === We built the profile because the boundary...")
- 04:56, 20 October 2015 (diff | hist) . . (+102) . . HMM PD0003
- 04:49, 20 October 2015 (diff | hist) . . (+1) . . HMM PD00142 (→Conserved region of MTMR14)
- 23:23, 19 October 2015 (diff | hist) . . (+88) . . HMM PD0003 (→Why built the HMM?)
- 22:10, 19 October 2015 (diff | hist) . . (+445) . . HMM PD0006 (current)
- 17:48, 19 October 2015 (diff | hist) . . (+259) . . N HMM PD00156 (Created page with "Back to '''List of HMMs''' '''Symbol''': vertebrate_PTP_PD '''Name''': Vertebrate PTP === Description === Download the alignment of 195 vertebrate PTP sequences at ...") (current)
- 17:45, 19 October 2015 (diff | hist) . . (+143) . . HMM (→HMMs for Finding Protein Phosphatase Domain with High Coverage)
- 04:21, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 04:21, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 01:37, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:37, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:25, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 01:25, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 20:08, 17 October 2015 (diff | hist) . . (0) . . m HMM PD00129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 20:08, 17 October 2015 (diff | hist) . . (+25) . . N HMM PD0129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 21:43, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:43, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:14, 16 October 2015 (diff | hist) . . (+48) . . HMM PD00144 (current)
- 21:14, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00144 (Mark moved page HMM PD0144 to HMM PD00144)
- 21:14, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0144 (Mark moved page HMM PD0144 to HMM PD00144) (current)
- 18:44, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00128 (Mark moved page HMM PD0128 to HMM PD00128)
- 18:44, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0128 (Mark moved page HMM PD0128 to HMM PD00128) (current)
- 21:25, 15 October 2015 (diff | hist) . . (-34) . . Phosphatase Subfamily FCP1 (→Domain Structure)
- 21:23, 15 October 2015 (diff | hist) . . (+249) . . Phosphatase Subfamily FCP1 Tech Notes (→Use Dicty FCP1 CTD) (current)
- 21:21, 15 October 2015 (diff | hist) . . (+393) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:17, 15 October 2015 (diff | hist) . . (+297) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:06, 15 October 2015 (diff | hist) . . (+105) . . N Phosphatase GeneID DdisP062 (Created page with "BRCT domain is at the C-terminal, so there must be no FCP1 CTD domain which is present in most eumetazoa.") (current)
- 21:00, 15 October 2015 (diff | hist) . . (+47) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (-29) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (+110) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:58, 15 October 2015 (diff | hist) . . (+50) . . HMM (→HMMs of accessory domains)
- 20:51, 15 October 2015 (diff | hist) . . (+2) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:46, 15 October 2015 (diff | hist) . . (+1,251) . . Phosphatase Subfamily FCP1 Tech Notes
- 20:42, 15 October 2015 (diff | hist) . . (+108) . . HMM (→HMMs of accessory domains)
- 20:40, 15 October 2015 (diff | hist) . . (+100) . . N HMM PD00155 (Created page with "See FCP1 technical notes about finding FCP1 CTD.") (current)
- 20:40, 15 October 2015 (diff | hist) . . (+424) . . HMM (→HMMs of accessory domains)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:58, 15 October 2015 (diff | hist) . . (+212) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:43, 15 October 2015 (diff | hist) . . (+1,338) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 17:38, 15 October 2015 (diff | hist) . . (+1,075) . . Phosphatase Subfamily FCP1 Tech Notes
- 07:06, 15 October 2015 (diff | hist) . . (-36) . . Phosphatase Subfamily Tensin (→Domain Structure)
- 21:20, 14 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0004 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0005 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0006 (Created page with "This is a stub page.")
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0007 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0009 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0010 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0021 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0011 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0012 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0013 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0014 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0015 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0018 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0019 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0001 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0016 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0017 (Created page with "This is a stub page.")
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0020 (Created page with "This is a stub page.") (current)
- 21:17, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0002 (Created page with "This is a stub page.") (current)
- 20:47, 14 October 2015 (diff | hist) . . (+16) . . Phosphatase Subfamily PTPRN Tech Note
- 19:00, 14 October 2015 (diff | hist) . . (+712) . . Phosphatase Subfamily PTPRN Tech Note
- 18:50, 14 October 2015 (diff | hist) . . (-1) . . HMM (→HMMs of accessory domains)
- 18:49, 14 October 2015 (diff | hist) . . (+823) . . N HMM PD00154 (Created page with "Back to '''List of HMMs''' '''Symbol''': VSP_VSD '''Name''': VSP, voltage sensor domain === Why built the HMM? === Voltage sensing domain is a transmembrane domain ...") (current)
- 18:37, 14 October 2015 (diff | hist) . . (+201) . . N HMM CA00001 (Created page with "PH domain is very diverse in sequence. To find PH domain, we searched PH domain against Pfam, SMART and CDD profiles. We also built in-house HMMs to find PH domains that were ...") (current)
- 18:23, 14 October 2015 (diff | hist) . . (+953) . . N Phosphatase Subfamily PTPRN Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 18:15, 14 October 2015 (diff | hist) . . (+139) . . Phosphatase Subfamily PTPRG Tech Note (→The gain of N-terminal Carbonic anhydrase (CA) domain) (current)
- 18:10, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRN
- 18:08, 14 October 2015 (diff | hist) . . (+66) . . Phosphatase Subfamily PTPRN (→Domain Structure)
- 18:02, 14 October 2015 (diff | hist) . . (+64) . . Phosphatase Subfamily PTPRG
- 17:58, 14 October 2015 (diff | hist) . . (+571) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+286) . . N Phosphatase Subfamily PTPRG Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 17:42, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRG
- 15:07, 13 October 2015 (diff | hist) . . (+289) . . Phosphatase Subfamily FCP1 Tech Notes
- 15:06, 13 October 2015 (diff | hist) . . (+665) . . N Phosphatase Subfamily FCP1 Tech Notes (Created page with "==== FCP1_C domain ==== In order to find FCP1_C domain phylogenetic distribution among FCP1, we obtained the FCP1 from our [http://resdev.gene.com/gOrtholog/view/cluster/MC000...")
- 15:06, 13 October 2015 (diff | hist) . . (-624) . . Phosphatase Subfamily FCP1 (→Technical notes)
- 07:34, 12 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs for Determining the Boundaries of Protein Phosphatase Domain)
- 05:36, 11 October 2015 (diff | hist) . . (+56) . . HMM (→HMMs of accessory domains)
- 20:45, 10 October 2015 (diff | hist) . . (+16) . . HMM (→HMMs of accessory domains)
- 20:40, 10 October 2015 (diff | hist) . . (+417) . . N HMM PD00152 (Created page with "Back to '''List of HMMs''' '''Symbol''': MTMR9_GRAM '''Name''': MTMR9, GRAM domain === Why built the HMM === Other profiles of PH domain can not detect all the PH/G...") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00137 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00136 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00135 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+311) . . HMM (→HMMs of accessory domains)
- 20:18, 10 October 2015 (diff | hist) . . (+1) . . Accesory Domain Gains and Losses (current)
- 20:18, 10 October 2015 (diff | hist) . . (+42) . . Accesory Domain Gains and Losses
- 18:46, 10 October 2015 (diff | hist) . . (+346) . . N HMM PD00151 (Created page with "Back to '''List of HMMs''' '''Symbol''': DnaJ_1 '''Name''': DnaJ domain built from SMART database alignment === Description === All the DnaJ domains of auxilins are...") (current)
- 18:43, 10 October 2015 (diff | hist) . . (+68) . . HMM (→HMMs of accessory domains)
- 02:37, 10 October 2015 (diff | hist) . . (+584) . . N Phosphatase GeneID NvecP030 (Created page with "The gene model built from JGI assembly lacks C1 domain. However, we updated the sequence based upon StellaBase assembly and transcriptome data. The resulting sequence has C1 d...") (current)
- 21:35, 9 October 2015 (diff | hist) . . (-2) . . HMM (→HMMs of accessory domains)
- 21:35, 9 October 2015 (diff | hist) . . (+595) . . HMM (→HMMs of accessory domains)
- 21:29, 9 October 2015 (diff | hist) . . (+113) . . HMM PD0003
- 19:56, 9 October 2015 (diff | hist) . . (+4) . . HMM PD0149 (→How the HMM was built) (current)
- 19:56, 9 October 2015 (diff | hist) . . (+4) . . HMM PD0149 (→Why built the HMM)
- 19:55, 9 October 2015 (diff | hist) . . (+8) . . HMM PD0149
- 19:55, 9 October 2015 (diff | hist) . . (+809) . . N HMM PD0149 (Created page with "Back to '''List of HMMs''' '''Symbol''': PH_1 '''Name''': PH domain === Why built the HMM === Because our in-house HMM MTMR_GRAM can not detect all PH do...")
- 19:49, 9 October 2015 (diff | hist) . . (+74) . . HMM (→HMMs of accessory domains)
- 19:00, 9 October 2015 (diff | hist) . . (+1,682) . . N HMM PD00148 (Created page with "Back to '''List of HMMs''' '''Symbol''': SSH_NTD '''Name''': Slingshot, N-terminal domain === Why built the HMM === The Phosphatase_Subfamily_Slingshot|Slingshot ...")
- 18:50, 9 October 2015 (diff | hist) . . (+104) . . HMM (→HMMs of accessory domains)
- 18:47, 9 October 2015 (diff | hist) . . (+371) . . N Phosphatase GeneID MbreP020 (Created page with "The sequence is supposed to have SSH, N-terminal domain, which is ~210 aa long right upstream of DEK_C domain. However, the corresponding region has no similari...") (current)
- 17:53, 9 October 2015 (diff | hist) . . (0) . . HMM PD0145 (current)
- 17:53, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs of accessory domains)
- 17:28, 9 October 2015 (diff | hist) . . (+193) . . Phosphatase GeneID DdisP008
- 17:24, 9 October 2015 (diff | hist) . . (+151) . . Phosphatase GeneID DdisP009
- 05:52, 9 October 2015 (diff | hist) . . (+168) . . N HMM PD0147 (Created page with "Back to '''List of HMMs''' '''Symbol''': WW '''Name''': WW === Description === We built HMM for WW domain. === How the HMM was built === Not validated, yet.") (current)
- 05:50, 9 October 2015 (diff | hist) . . (+1) . . HMM (→HMMs of accessory domains)
- 05:50, 9 October 2015 (diff | hist) . . (+49) . . HMM (→HMMs of accessory domains)
- 05:49, 9 October 2015 (diff | hist) . . (+782) . . N HMM PD0145 (Created page with "Back to '''List of HMMs''' '''Symbol''': SAC9_NTD1 '''Name''': SAC9, N-Terminal Domain 1 === Why built the HMM? === We noticed Ddis051 ...")
- 05:18, 9 October 2015 (diff | hist) . . (+7) . . HMM PD00128
- 05:18, 9 October 2015 (diff | hist) . . (+39) . . N HMM PD0146 (Created page with "See SAC9_NTD1 (PD00145).") (current)
- 05:17, 9 October 2015 (diff | hist) . . (+135) . . HMM (→HMMs of accessory domains)
- 04:36, 9 October 2015 (diff | hist) . . (+104) . . HMM (→HMMs of accessory domains)
- 01:32, 9 October 2015 (diff | hist) . . (+947) . . N HMM PD00144 (Created page with "Back to '''List of HMMs''' '''Symbol''': IPPc '''Name''': IPPc === Description === We built HMM for IPPc domain, because the Pfam profiles [http://pfam.xfam.org/fam...")
- 01:24, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs of accessory domains)
- 01:24, 9 October 2015 (diff | hist) . . (+130) . . HMM (→HMMs of accessory domains)
- 01:22, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs for Finding Protein Phosphatase Domain with high coverage)
- 21:26, 8 October 2015 (diff | hist) . . (+232) . . Accesory Domain Gains and Losses
- 20:40, 8 October 2015 (diff | hist) . . (+195) . . N Phosphatase GeneID DdisP009 (Created page with "Unusual domain combination of uncertain origin. If the common ancestor of Dictyostelium and opisthokonta has rhodanese domain, it is lost in Dictystelium; otherwise, it is gai...")
- 20:39, 8 October 2015 (diff | hist) . . (+195) . . N Phosphatase GeneID DdisP008 (Created page with "Unusual domain combination of uncertain origin. If the common ancestor of Dictyostelium and opisthokonta has rhodanese domain, it is lost in Dictystelium; otherwise, it is gai...")
- 18:14, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP779 (Created page with "No known function.") (current)
- 18:14, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP781 (Created page with "No known function.") (current)
- 18:13, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP780 (Created page with "No known function.") (current)
- 18:12, 8 October 2015 (diff | hist) . . (+8) . . N Phosphatase Gene HsapP778 (Created page with "PPP2CBP1") (current)
- 18:12, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP777 (Created page with "No known function.") (current)
- 18:11, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP775 (Created page with "No known function.") (current)
- 18:11, 8 October 2015 (diff | hist) . . (+155) . . Human Protein Phosphatase Pseudogene (→Functions) (current)
- 18:09, 8 October 2015 (diff | hist) . . (+310) . . Human Protein Phosphatase Pseudogene
- 18:07, 8 October 2015 (diff | hist) . . (+136) . . Human Protein Phosphatase Pseudogene
- 18:05, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP774 (Created page with "No known function.") (current)
- 18:05, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP773 (Created page with "No known function.") (current)
- 18:05, 8 October 2015 (diff | hist) . . (+14) . . Human Protein Phosphatase Pseudogene
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP772 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP771 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP770 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP769 (Created page with "No known function.") (current)
- 18:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP768 (Created page with "No known function.") (current)
(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)