User contributions
(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)
- 18:30, 15 March 2017 (diff | hist) . . (+251) . . N HMM PD00171 (Created page with "Back to '''List of HMMs''' '''Symbol''': RA '''Name''': Ras Association === Why built the HMM === Human PHLPPs have RA domains, but they are not found by Pfam, SM...")
- 18:26, 15 March 2017 (diff | hist) . . (+44) . . HMM (→HMMs of accessory domains) (current)
- 19:38, 9 March 2017 (diff | hist) . . (+9) . . Phosphatase Subfamily PHLPP (→PH domain of PHLPP)
- 20:23, 23 February 2017 (diff | hist) . . (+21) . . N Phosphatase GeneID AqueP052 (Created page with "Merged into AqueP053.") (current)
- 20:18, 23 February 2017 (diff | hist) . . (+1) . . Phosphatase GeneID SpurP099 (current)
- 20:18, 23 February 2017 (diff | hist) . . (0) . . Phosphatase GeneID SpurP099
- 20:18, 23 February 2017 (diff | hist) . . (+21) . . N Phosphatase GeneID SpurP101 (Created page with "Merged into SpurP098.") (current)
- 20:17, 23 February 2017 (diff | hist) . . (+20) . . N Phosphatase GeneID SpurP099 (Created page with "Merge with SpurP098.")
- 20:36, 7 January 2017 (diff | hist) . . (+25) . . Phosphatase Subfamily PTPN6 (→References) (current)
- 20:36, 7 January 2017 (diff | hist) . . (+168) . . Phosphatase Subfamily PTPN6 (→PTPN11/SHP2)
- 14:13, 6 January 2017 (diff | hist) . . (+27) . . Phosphatase Subfamily PTPRB (→References)
- 14:13, 6 January 2017 (diff | hist) . . (+451) . . Phosphatase Subfamily PTPRB (→PTPRJ (CD148/DEP1/RPTP eta))
- 13:55, 6 January 2017 (diff | hist) . . (+24) . . Phosphatase Subfamily PPP7C (→References)
- 13:54, 6 January 2017 (diff | hist) . . (+304) . . Phosphatase Subfamily PPP7C (→Functions)
- 17:39, 3 January 2017 (diff | hist) . . (+157) . . Phosphatase Subfamily PPP3C (→PPP3CC)
- 17:38, 3 January 2017 (diff | hist) . . (+237) . . Phosphatase Subfamily PPP3C (→Functions)
- 21:16, 10 November 2016 (diff | hist) . . (+463) . . N Wiki Management (Created page with "=== Citations === We use BiblioPlus for automated retrieval and formatting of citations from PubMed and the ISBN databases. However, it failed in Nov, 2016, because [https:...") (current)
- 21:10, 10 November 2016 (diff | hist) . . (+10) . . Main Page (→Technical notes)
- 21:10, 10 November 2016 (diff | hist) . . (+28) . . Main Page (→Technical notes)
- 14:56, 9 September 2016 (diff | hist) . . (+26) . . Phosphatase Subfamily YMR1 (→References)
- 14:56, 9 September 2016 (diff | hist) . . (+69) . . Phosphatase Subfamily YMR1 (→Catalytic activity and functions)
- 14:54, 9 September 2016 (diff | hist) . . (-34) . . Phosphatase Subfamily MTMR1 (→Catalytic activity and functions)
- 16:07, 7 September 2016 (diff | hist) . . (-88) . . Phosphatase Subfamily MTMR1 (→Domain Structure)
- 16:05, 7 September 2016 (diff | hist) . . (-88) . . Phosphatase Subfamily MTMR9 (→Domain Structure) (current)
- 20:06, 31 August 2016 (diff | hist) . . (0) . . Phosphatase Subfamily STS (→References)
- 00:12, 15 May 2016 (diff | hist) . . (-5) . . CTD Phosphorylation (→Phosphatases) (current)
- 00:12, 15 May 2016 (diff | hist) . . (-3) . . CTD Phosphorylation (→Phosphatases)
- 00:10, 15 May 2016 (diff | hist) . . (-42) . . CTD Phosphorylation (→Phosphatases)
- 00:09, 15 May 2016 (diff | hist) . . (-3) . . CTD Phosphorylation (→Phosphatases)
- 00:09, 15 May 2016 (diff | hist) . . (+276) . . CTD Phosphorylation (→Phosphatases)
- 00:03, 15 May 2016 (diff | hist) . . (-4) . . CTD Phosphorylation (→Phosphatases)
- 23:06, 14 May 2016 (diff | hist) . . (-17) . . CTD Phosphorylation (→Phosphatases)
- 23:05, 14 May 2016 (diff | hist) . . (+30) . . CTD Phosphorylation (→Phosphatases)
- 23:03, 14 May 2016 (diff | hist) . . (+154) . . CTD Phosphorylation (→Phosphatases)
- 23:01, 14 May 2016 (diff | hist) . . (-63) . . CTD Phosphorylation (→Kinases)
- 23:01, 14 May 2016 (diff | hist) . . (+6) . . CTD Phosphorylation (→Kinases)
- 22:06, 11 May 2016 (diff | hist) . . (+104) . . N Phosphatase GeneID MbreP062 (Created page with "The domain combination of PTP and PDZ is supported by S. rosetta XP_004995601.1 and M. ovata BAJ52657.1.") (current)
- 18:10, 11 May 2016 (diff | hist) . . (+206) . . N Phosphatase GeneID MbreP044 (Created page with "The presence of WW domain is supported by XP_004997059 (S. Rosetta) and BAJ52652 (M. ovata). The two sequences have an additional EF-hand domain at the C-terminal, which is ab...") (current)
- 21:37, 10 May 2016 (diff | hist) . . (+529) . . N Phosphatase GeneID MbreP035 (Created page with "The full sequence is longer than Entrez gene model (protein sequence XP_001745699.1). It is supported by S. Rosetta XP_004998982.1. MRYQDFYDIGRDQPATASYANPNLLKNRYGNIVAYDAGRVKL...") (current)
- 18:46, 10 May 2016 (diff | hist) . . (+168) . . N Phosphatase GeneID MbreP068 (Created page with "We update the gene model using cDNA GenBank: KM609288.1 reported of cloning Monosiga SHP <cite>Zhao14</cite>. == References == <biblio> #Zhao14 pmid=25445586 </biblio>") (current)
- 17:53, 10 May 2016 (diff | hist) . . (+578) . . Phosphatase Family PTP (→Receptor PTPs)
- 17:52, 10 May 2016 (diff | hist) . . (-201) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 17:52, 10 May 2016 (diff | hist) . . (-314) . . Phosphatase Family PTP (→Receptor PTPs)
- 17:23, 10 May 2016 (diff | hist) . . (+84) . . N Phosphatase GeneID SpurP051 (Created page with "Change the classification from PTP-unclassified to SpurPTP-sf1 (date: May 10, 2016).") (current)
- 17:10, 10 May 2016 (diff | hist) . . (+434) . . Phosphatase GeneID SpurP054 (current)
- 16:50, 10 May 2016 (diff | hist) . . (+54) . . Phosphatase GeneID SpurP050 (current)
- 16:48, 10 May 2016 (diff | hist) . . (+930) . . N Phosphatase GeneID SpurP050 (Created page with "We have the sequence as: XRFSISWPRVLPKGTLAGGVNQAGLDYYTNLIDELLANDIEPVVTLYHWDLPQVLQDDYGGWENDSLTDLFNDYANLCFNEYASKVNLWITFNEPYVVTWLGYGIGVFAPGVYSPGYAPYRAAHTIIKAHAKAYNTYRANYFPQYGGKV...")
- 20:24, 8 May 2016 (diff | hist) . . (+326) . . Phosphatase Family PTP (→Receptor PTPs)
- 20:22, 8 May 2016 (diff | hist) . . (-262) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 20:16, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID CeleP222 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:13, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID AqueP047 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:31, 3 May 2016 (diff | hist) . . (0) . . Phosphatase Family PTP
- 20:22, 29 April 2016 (diff | hist) . . (+81) . . Phosphatase Subfamily PPM1A (→Different functions of PPM1A and PPM1B)
- 20:45, 27 April 2016 (diff | hist) . . (+25) . . Phosphatase Subfamily PTEN (→References)
- 20:44, 27 April 2016 (diff | hist) . . (+175) . . Phosphatase Subfamily PTEN (→Functions)
- 18:28, 22 March 2016 (diff | hist) . . (-1) . . Phosphatase Subfamily PTPRG (→Evolution)
- 19:57, 17 March 2016 (diff | hist) . . (-126) . . Phosphatase Subfamily MTMR14 (→Domain Structure)
- 18:23, 16 March 2016 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 17:16, 16 March 2016 (diff | hist) . . (+78) . . N Phosphatase GeneID SpurP151 (Created page with "Removed. It is redundant to SpurP152. Its sequence is a substring of SpurP152.") (current)
- 00:09, 14 March 2016 (diff | hist) . . (-28) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:28, 12 March 2016 (diff | hist) . . (+119) . . Phosphatase Subfamily PTPN5 RR (→PTPN7 (HePTP/LC-PTP))
- 18:21, 7 March 2016 (diff | hist) . . (+20) . . N Phosphatase GeneID CeleP183 (Created page with "This is a stub page.") (current)
- 18:17, 7 March 2016 (diff | hist) . . (+40) . . N Phosphatase Subfamily Rtr1 (Redirected page to Phosphatase Subfamily RTR1) (current)
- 00:49, 1 March 2016 (diff | hist) . . (-5) . . Phosphatase Subfamily AP
- 01:46, 12 February 2016 (diff | hist) . . (-18) . . Pseudophosphatases (→CC1 fold)
- 23:39, 11 February 2016 (diff | hist) . . (+273) . . Pseudophosphatases (→HP1 family)
- 23:35, 11 February 2016 (diff | hist) . . (+161) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+1) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+628) . . Pseudophosphatases
- 23:19, 11 February 2016 (diff | hist) . . (+43) . . N Pseudophosphatases (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
- 20:14, 8 December 2015 (diff | hist) . . (+15) . . Pseudophosphatases (obsolete)
- 20:11, 8 December 2015 (diff | hist) . . (+6) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:36, 7 December 2015 (diff | hist) . . (+100) . . Phosphatase Subfamily DSP3 (→DUSP27) (current)
- 20:00, 7 December 2015 (diff | hist) . . (+389) . . Phosphatase Subfamily DSP3 (→Function)
- 22:50, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP
- 21:08, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP (→References)
- 21:08, 4 December 2015 (diff | hist) . . (+201) . . Phosphatase Family PTP (→Second phosphatase domain (D2))
- 21:02, 4 December 2015 (diff | hist) . . (+383) . . Phosphatase Family PTP
- 00:45, 20 November 2015 (diff | hist) . . (+56) . . Phosphatase Family CDC25 (→Acr2) (current)
- 00:44, 20 November 2015 (diff | hist) . . (+146) . . Phosphatase Family CDC25 (→CDC25/YCH1)
- 00:40, 20 November 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 00:40, 20 November 2015 (diff | hist) . . (+35) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 06:46, 18 November 2015 (diff | hist) . . (+175) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 20:58, 17 November 2015 (diff | hist) . . (+248) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 19:27, 17 November 2015 (diff | hist) . . (+1,180) . . HMM PD0017 (current)
- 19:18, 17 November 2015 (diff | hist) . . (+1,221) . . Phosphatase Family PPM
- 21:34, 16 November 2015 (diff | hist) . . (+189) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure) (current)
- 19:03, 16 November 2015 (diff | hist) . . (+118) . . Phosphatase Family CDC25 (→Acr2)
- 06:35, 16 November 2015 (diff | hist) . . (+1,292) . . Phosphatase Family CDC25
- 02:00, 16 November 2015 (diff | hist) . . (+126) . . Phosphatase Subfamily CDC25 (→Phosphatase domain structure)
- 01:56, 16 November 2015 (diff | hist) . . (+1,014) . . Phosphatase Subfamily CDC25
- 07:36, 15 November 2015 (diff | hist) . . (+11) . . Phosphatase Superfamily CC2
- 07:34, 15 November 2015 (diff | hist) . . (+55) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:32, 15 November 2015 (diff | hist) . . (-22) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:30, 15 November 2015 (diff | hist) . . (+944) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 06:22, 15 November 2015 (diff | hist) . . (+355) . . Phosphatase Superfamily CC2
- 21:22, 13 November 2015 (diff | hist) . . (+1,707) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 21:03, 11 November 2015 (diff | hist) . . (+83) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 20:14, 11 November 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily DSP1
- 20:10, 11 November 2015 (diff | hist) . . (-16) . . Phosphatase Family DSP
- 20:06, 11 November 2015 (diff | hist) . . (+8) . . Phosphatase Family DSP
- 20:05, 11 November 2015 (diff | hist) . . (+17) . . Phosphatase Family DSP
- 20:03, 11 November 2015 (diff | hist) . . (+851) . . Phosphatase Family DSP
- 19:57, 11 November 2015 (diff | hist) . . (+65) . . Phosphatase Fold CC1
- 19:57, 11 November 2015 (diff | hist) . . (-442) . . Phosphatase Fold CC1
- 18:42, 3 November 2015 (diff | hist) . . (+281) . . Phosphatase Subfamily PTPN5 RR (→Domains)
- 21:16, 28 October 2015 (diff | hist) . . (+106) . . Phosphatase Fold CC1 (→Structure)
- 20:43, 28 October 2015 (diff | hist) . . (-40) . . Phosphatase Fold CC1
- 20:42, 28 October 2015 (diff | hist) . . (+217) . . Phosphatase Fold CC1
- 20:38, 28 October 2015 (diff | hist) . . (+778) . . Phosphatase Fold CC1
- 20:25, 28 October 2015 (diff | hist) . . (+92) . . Phosphatase Family Sac (→Phosphatase domain)
- 20:18, 28 October 2015 (diff | hist) . . (+21) . . HMM PD00008 (→References)
- 18:21, 28 October 2015 (diff | hist) . . (+45) . . Phosphatase Family Myotubularin (→References)
- 18:20, 28 October 2015 (diff | hist) . . (+876) . . Phosphatase Family Myotubularin (→Myotubularin phosphatase domain)
- 17:49, 28 October 2015 (diff | hist) . . (0) . . m HMM PD00142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:49, 28 October 2015 (diff | hist) . . (+25) . . N HMM PD0142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:48, 28 October 2015 (diff | hist) . . (+483) . . Phosphatase Family Myotubularin
- 22:15, 26 October 2015 (diff | hist) . . (-2,611) . . HMM PD00142
- 22:13, 26 October 2015 (diff | hist) . . (+122) . . HMM PD00142 (→Obtain phosphatase domain)
- 22:57, 21 October 2015 (diff | hist) . . (+11) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:41, 20 October 2015 (diff | hist) . . (+123) . . HMM PD00008 (→Description)
- 18:35, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00008 (→Description)
- 18:26, 20 October 2015 (diff | hist) . . (+925) . . Phosphatase Family Sac
- 18:25, 20 October 2015 (diff | hist) . . (+25) . . N HMM PD0008 (Mark moved page HMM PD0008 to HMM PD00008) (current)
- 18:25, 20 October 2015 (diff | hist) . . (0) . . m HMM PD00008 (Mark moved page HMM PD0008 to HMM PD00008)
- 18:20, 20 October 2015 (diff | hist) . . (+395) . . HMM PD00008 (→Description)
- 05:06, 20 October 2015 (diff | hist) . . (+140) . . HMM PD00142 (→How was the HMM built?)
- 05:01, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00142 (→Conserved region of MTMR14)
- 05:00, 20 October 2015 (diff | hist) . . (+44) . . HMM PD00143 (→Conserved region of MTMR14) (current)
- 04:59, 20 October 2015 (diff | hist) . . (+7) . . HMM PD0003 (→How the HMM was built) (current)
- 04:58, 20 October 2015 (diff | hist) . . (+3,887) . . N HMM PD00143 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_MTM_MTMR14_CR '''Name''': MTMR14 conserved regions === Why built the HMM? === We built the profile because the boundary...")
- 04:56, 20 October 2015 (diff | hist) . . (+102) . . HMM PD0003
- 04:49, 20 October 2015 (diff | hist) . . (+1) . . HMM PD00142 (→Conserved region of MTMR14)
- 23:23, 19 October 2015 (diff | hist) . . (+88) . . HMM PD0003 (→Why built the HMM?)
- 22:10, 19 October 2015 (diff | hist) . . (+445) . . HMM PD0006 (current)
- 17:48, 19 October 2015 (diff | hist) . . (+259) . . N HMM PD00156 (Created page with "Back to '''List of HMMs''' '''Symbol''': vertebrate_PTP_PD '''Name''': Vertebrate PTP === Description === Download the alignment of 195 vertebrate PTP sequences at ...") (current)
- 17:45, 19 October 2015 (diff | hist) . . (+143) . . HMM (→HMMs for Finding Protein Phosphatase Domain with High Coverage)
- 04:21, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 04:21, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 01:37, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:37, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:25, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 01:25, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 20:08, 17 October 2015 (diff | hist) . . (0) . . m HMM PD00129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 20:08, 17 October 2015 (diff | hist) . . (+25) . . N HMM PD0129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 21:43, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:43, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:14, 16 October 2015 (diff | hist) . . (+48) . . HMM PD00144 (current)
- 21:14, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00144 (Mark moved page HMM PD0144 to HMM PD00144)
- 21:14, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0144 (Mark moved page HMM PD0144 to HMM PD00144) (current)
- 18:44, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00128 (Mark moved page HMM PD0128 to HMM PD00128)
- 18:44, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0128 (Mark moved page HMM PD0128 to HMM PD00128) (current)
- 21:25, 15 October 2015 (diff | hist) . . (-34) . . Phosphatase Subfamily FCP1 (→Domain Structure)
- 21:23, 15 October 2015 (diff | hist) . . (+249) . . Phosphatase Subfamily FCP1 Tech Notes (→Use Dicty FCP1 CTD) (current)
- 21:21, 15 October 2015 (diff | hist) . . (+393) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:17, 15 October 2015 (diff | hist) . . (+297) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:06, 15 October 2015 (diff | hist) . . (+105) . . N Phosphatase GeneID DdisP062 (Created page with "BRCT domain is at the C-terminal, so there must be no FCP1 CTD domain which is present in most eumetazoa.") (current)
- 21:00, 15 October 2015 (diff | hist) . . (+47) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (-29) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (+110) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:58, 15 October 2015 (diff | hist) . . (+50) . . HMM (→HMMs of accessory domains)
- 20:51, 15 October 2015 (diff | hist) . . (+2) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:46, 15 October 2015 (diff | hist) . . (+1,251) . . Phosphatase Subfamily FCP1 Tech Notes
- 20:42, 15 October 2015 (diff | hist) . . (+108) . . HMM (→HMMs of accessory domains)
- 20:40, 15 October 2015 (diff | hist) . . (+100) . . N HMM PD00155 (Created page with "See FCP1 technical notes about finding FCP1 CTD.") (current)
- 20:40, 15 October 2015 (diff | hist) . . (+424) . . HMM (→HMMs of accessory domains)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:58, 15 October 2015 (diff | hist) . . (+212) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:43, 15 October 2015 (diff | hist) . . (+1,338) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 17:38, 15 October 2015 (diff | hist) . . (+1,075) . . Phosphatase Subfamily FCP1 Tech Notes
- 07:06, 15 October 2015 (diff | hist) . . (-36) . . Phosphatase Subfamily Tensin (→Domain Structure)
- 21:20, 14 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0004 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0005 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0006 (Created page with "This is a stub page.")
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0007 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0009 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0010 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0021 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0011 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0012 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0013 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0014 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0015 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0018 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0019 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0001 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0016 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0017 (Created page with "This is a stub page.")
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0020 (Created page with "This is a stub page.") (current)
- 21:17, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0002 (Created page with "This is a stub page.") (current)
- 20:47, 14 October 2015 (diff | hist) . . (+16) . . Phosphatase Subfamily PTPRN Tech Note
- 19:00, 14 October 2015 (diff | hist) . . (+712) . . Phosphatase Subfamily PTPRN Tech Note
- 18:50, 14 October 2015 (diff | hist) . . (-1) . . HMM (→HMMs of accessory domains)
- 18:49, 14 October 2015 (diff | hist) . . (+823) . . N HMM PD00154 (Created page with "Back to '''List of HMMs''' '''Symbol''': VSP_VSD '''Name''': VSP, voltage sensor domain === Why built the HMM? === Voltage sensing domain is a transmembrane domain ...") (current)
- 18:37, 14 October 2015 (diff | hist) . . (+201) . . N HMM CA00001 (Created page with "PH domain is very diverse in sequence. To find PH domain, we searched PH domain against Pfam, SMART and CDD profiles. We also built in-house HMMs to find PH domains that were ...") (current)
- 18:23, 14 October 2015 (diff | hist) . . (+953) . . N Phosphatase Subfamily PTPRN Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 18:15, 14 October 2015 (diff | hist) . . (+139) . . Phosphatase Subfamily PTPRG Tech Note (→The gain of N-terminal Carbonic anhydrase (CA) domain) (current)
- 18:10, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRN
- 18:08, 14 October 2015 (diff | hist) . . (+66) . . Phosphatase Subfamily PTPRN (→Domain Structure)
- 18:02, 14 October 2015 (diff | hist) . . (+64) . . Phosphatase Subfamily PTPRG
- 17:58, 14 October 2015 (diff | hist) . . (+571) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+286) . . N Phosphatase Subfamily PTPRG Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 17:42, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRG
- 15:07, 13 October 2015 (diff | hist) . . (+289) . . Phosphatase Subfamily FCP1 Tech Notes
- 15:06, 13 October 2015 (diff | hist) . . (+665) . . N Phosphatase Subfamily FCP1 Tech Notes (Created page with "==== FCP1_C domain ==== In order to find FCP1_C domain phylogenetic distribution among FCP1, we obtained the FCP1 from our [http://resdev.gene.com/gOrtholog/view/cluster/MC000...")
- 15:06, 13 October 2015 (diff | hist) . . (-624) . . Phosphatase Subfamily FCP1 (→Technical notes)
- 07:34, 12 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs for Determining the Boundaries of Protein Phosphatase Domain)
- 05:36, 11 October 2015 (diff | hist) . . (+56) . . HMM (→HMMs of accessory domains)
- 20:45, 10 October 2015 (diff | hist) . . (+16) . . HMM (→HMMs of accessory domains)
- 20:40, 10 October 2015 (diff | hist) . . (+417) . . N HMM PD00152 (Created page with "Back to '''List of HMMs''' '''Symbol''': MTMR9_GRAM '''Name''': MTMR9, GRAM domain === Why built the HMM === Other profiles of PH domain can not detect all the PH/G...") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00137 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00136 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00135 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+311) . . HMM (→HMMs of accessory domains)
- 20:18, 10 October 2015 (diff | hist) . . (+1) . . Accesory Domain Gains and Losses (current)
- 20:18, 10 October 2015 (diff | hist) . . (+42) . . Accesory Domain Gains and Losses
(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)