User contributions
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 20:13, 8 May 2016 (diff | hist) . . (+98) . . N Phosphatase GeneID AqueP047 (Created page with "It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.") (current)
- 20:31, 3 May 2016 (diff | hist) . . (0) . . Phosphatase Family PTP
- 20:22, 29 April 2016 (diff | hist) . . (+81) . . Phosphatase Subfamily PPM1A (→Different functions of PPM1A and PPM1B)
- 20:45, 27 April 2016 (diff | hist) . . (+25) . . Phosphatase Subfamily PTEN (→References)
- 20:44, 27 April 2016 (diff | hist) . . (+175) . . Phosphatase Subfamily PTEN (→Functions)
- 18:28, 22 March 2016 (diff | hist) . . (-1) . . Phosphatase Subfamily PTPRG (→Evolution)
- 19:57, 17 March 2016 (diff | hist) . . (-126) . . Phosphatase Subfamily MTMR14 (→Domain Structure)
- 18:23, 16 March 2016 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 17:16, 16 March 2016 (diff | hist) . . (+78) . . N Phosphatase GeneID SpurP151 (Created page with "Removed. It is redundant to SpurP152. Its sequence is a substring of SpurP152.") (current)
- 00:09, 14 March 2016 (diff | hist) . . (-28) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:28, 12 March 2016 (diff | hist) . . (+119) . . Phosphatase Subfamily PTPN5 RR (→PTPN7 (HePTP/LC-PTP))
- 18:21, 7 March 2016 (diff | hist) . . (+20) . . N Phosphatase GeneID CeleP183 (Created page with "This is a stub page.") (current)
- 18:17, 7 March 2016 (diff | hist) . . (+40) . . N Phosphatase Subfamily Rtr1 (Redirected page to Phosphatase Subfamily RTR1) (current)
- 00:49, 1 March 2016 (diff | hist) . . (-5) . . Phosphatase Subfamily AP
- 01:46, 12 February 2016 (diff | hist) . . (-18) . . Pseudophosphatases (→CC1 fold)
- 23:39, 11 February 2016 (diff | hist) . . (+273) . . Pseudophosphatases (→HP1 family)
- 23:35, 11 February 2016 (diff | hist) . . (+161) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+1) . . Pseudophosphatases (→PFKFB subfamily)
- 23:33, 11 February 2016 (diff | hist) . . (+628) . . Pseudophosphatases
- 23:19, 11 February 2016 (diff | hist) . . (+43) . . N Pseudophosphatases (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 23:19, 11 February 2016 (diff | hist) . . (0) . . m Pseudophosphatases (obsolete) (Mark moved page Pseudophosphatases to Pseudophosphatases (obsolete))
- 21:45, 8 February 2016 (diff | hist) . . (+4,098) . . N Phosphatase GeneID SpurP115 (Created page with "SpurP115 is merged into SpurP067. SpurP115 is on a separate contig to SpurP067 but is linked via a transcript assembly that you can see at UCSC. Here’s the new full length ...") (current)
- 20:44, 8 February 2016 (diff | hist) . . (+20) . . Phosphatase Family PPM (→References)
- 20:44, 8 February 2016 (diff | hist) . . (+109) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 18:11, 5 February 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily DSP6 (→Domain)
- 18:11, 5 February 2016 (diff | hist) . . (+223) . . Phosphatase Subfamily DSP6 (→Nematodes lost rhodanese domain)
- 18:02, 5 February 2016 (diff | hist) . . (+20) . . Phosphatase Subfamily DSP10 (→Evolution)
- 18:00, 5 February 2016 (diff | hist) . . (+82) . . Phosphatase Subfamily DSP10 (→Evolution)
- 22:49, 15 January 2016 (diff | hist) . . (+752) . . Phosphatase Subamily Paladin
- 22:33, 15 January 2016 (diff | hist) . . (+419) . . Phosphatase Subamily Paladin (→Domain)
- 19:21, 4 January 2016 (diff | hist) . . (+43) . . Phosphatase Subfamily Ptp36E (→Domains)
- 19:18, 4 January 2016 (diff | hist) . . (+1,482) . . N Phosphatase GeneID SpurP048 (Created page with "No transmembrane region according to the prediction of TMHMM using the sequence below: METGLVVSPSEYTLTDLDTFPVWKPSCPLVSTFYCSPIRVPGLGTVQRVPKRVRGSPQLLESLGLDYKENKYACQMPGLAVALEPPN...") (current)
- 19:10, 4 January 2016 (diff | hist) . . (+44) . . Phosphatase Subfamily Ptp36E (→Evolution)
- 18:43, 4 January 2016 (diff | hist) . . (-83) . . Phosphatase GeneID DmelP037 (current)
- 18:43, 4 January 2016 (diff | hist) . . (+390) . . N Phosphatase GeneID DmelP037 (Created page with "Ptp36E locates within the introns of CG42750, which encodes renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipept...")
- 18:41, 4 January 2016 (diff | hist) . . (+262) . . Phosphatase Subfamily Ptp36E (→Domains)
- 18:37, 4 January 2016 (diff | hist) . . (+145) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+10) . . Phosphatase Subfamily Ptp36E
- 18:32, 4 January 2016 (diff | hist) . . (+403) . . N Phosphatase Subfamily Ptp36E (Created page with "Phosphatase Classification: Fold CC1: Superfamily CC1: Phosphatase_Family_PTP|Family...")
- 18:29, 4 January 2016 (diff | hist) . . (+9) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:28, 4 January 2016 (diff | hist) . . (+85) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:27, 4 January 2016 (diff | hist) . . (-129) . . Phosphatase Family PTP (→Receptor PTPs)
- 01:25, 4 January 2016 (diff | hist) . . (+5) . . Phosphatase Subfamily PTPRN (→Evolution)
- 18:40, 15 December 2015 (diff | hist) . . (+124) . . Phosphatases and Diseases
- 05:00, 14 December 2015 (diff | hist) . . (-3) . . Phosphatase Family PTP (→Receptor PTPs)
- 04:59, 14 December 2015 (diff | hist) . . (-6) . . Phosphatase Subfamily PTPRN
- 21:04, 10 December 2015 (diff | hist) . . (+1,550) . . Phosphatase Family HP2
- 01:54, 9 December 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR10
- 20:25, 8 December 2015 (diff | hist) . . (+337) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:17, 8 December 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete)
- 20:14, 8 December 2015 (diff | hist) . . (+15) . . Pseudophosphatases (obsolete)
- 20:11, 8 December 2015 (diff | hist) . . (+6) . . Phosphatase Family PTP (→Phosphatase Domain)
- 20:36, 7 December 2015 (diff | hist) . . (+100) . . Phosphatase Subfamily DSP3 (→DUSP27) (current)
- 20:00, 7 December 2015 (diff | hist) . . (+389) . . Phosphatase Subfamily DSP3 (→Function)
- 22:50, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP
- 21:08, 4 December 2015 (diff | hist) . . (+25) . . Phosphatase Family PTP (→References)
- 21:08, 4 December 2015 (diff | hist) . . (+201) . . Phosphatase Family PTP (→Second phosphatase domain (D2))
- 21:02, 4 December 2015 (diff | hist) . . (+383) . . Phosphatase Family PTP
- 00:45, 20 November 2015 (diff | hist) . . (+56) . . Phosphatase Family CDC25 (→Acr2) (current)
- 00:44, 20 November 2015 (diff | hist) . . (+146) . . Phosphatase Family CDC25 (→CDC25/YCH1)
- 00:40, 20 November 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 00:40, 20 November 2015 (diff | hist) . . (+35) . . Phosphatase Subfamily Acr2 (→Saccharomyces cerevisiae)
- 06:46, 18 November 2015 (diff | hist) . . (+175) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 20:58, 17 November 2015 (diff | hist) . . (+248) . . Phosphatase Family PPM (→Phosphatase domain structure)
- 19:27, 17 November 2015 (diff | hist) . . (+1,180) . . HMM PD0017 (current)
- 19:18, 17 November 2015 (diff | hist) . . (+1,221) . . Phosphatase Family PPM
- 21:34, 16 November 2015 (diff | hist) . . (+189) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure) (current)
- 19:03, 16 November 2015 (diff | hist) . . (+118) . . Phosphatase Family CDC25 (→Acr2)
- 06:35, 16 November 2015 (diff | hist) . . (+1,292) . . Phosphatase Family CDC25
- 02:00, 16 November 2015 (diff | hist) . . (+126) . . Phosphatase Subfamily CDC25 (→Phosphatase domain structure)
- 01:56, 16 November 2015 (diff | hist) . . (+1,014) . . Phosphatase Subfamily CDC25
- 07:36, 15 November 2015 (diff | hist) . . (+11) . . Phosphatase Superfamily CC2
- 07:34, 15 November 2015 (diff | hist) . . (+55) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:32, 15 November 2015 (diff | hist) . . (-22) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 07:30, 15 November 2015 (diff | hist) . . (+944) . . Phosphatase Superfamily CC2 (→Phosphatase domain structure)
- 06:22, 15 November 2015 (diff | hist) . . (+355) . . Phosphatase Superfamily CC2
- 21:22, 13 November 2015 (diff | hist) . . (+1,707) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 21:03, 11 November 2015 (diff | hist) . . (+83) . . Phosphatase Family DSP (→Phosphatase domain structures)
- 20:14, 11 November 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily DSP1
- 20:10, 11 November 2015 (diff | hist) . . (-16) . . Phosphatase Family DSP
- 20:06, 11 November 2015 (diff | hist) . . (+8) . . Phosphatase Family DSP
- 20:05, 11 November 2015 (diff | hist) . . (+17) . . Phosphatase Family DSP
- 20:03, 11 November 2015 (diff | hist) . . (+851) . . Phosphatase Family DSP
- 19:57, 11 November 2015 (diff | hist) . . (+65) . . Phosphatase Fold CC1
- 19:57, 11 November 2015 (diff | hist) . . (-442) . . Phosphatase Fold CC1
- 18:42, 3 November 2015 (diff | hist) . . (+281) . . Phosphatase Subfamily PTPN5 RR (→Domains)
- 21:16, 28 October 2015 (diff | hist) . . (+106) . . Phosphatase Fold CC1 (→Structure)
- 20:43, 28 October 2015 (diff | hist) . . (-40) . . Phosphatase Fold CC1
- 20:42, 28 October 2015 (diff | hist) . . (+217) . . Phosphatase Fold CC1
- 20:38, 28 October 2015 (diff | hist) . . (+778) . . Phosphatase Fold CC1
- 20:25, 28 October 2015 (diff | hist) . . (+92) . . Phosphatase Family Sac (→Phosphatase domain)
- 20:18, 28 October 2015 (diff | hist) . . (+21) . . HMM PD00008 (→References)
- 18:21, 28 October 2015 (diff | hist) . . (+45) . . Phosphatase Family Myotubularin (→References)
- 18:20, 28 October 2015 (diff | hist) . . (+876) . . Phosphatase Family Myotubularin (→Myotubularin phosphatase domain)
- 17:49, 28 October 2015 (diff | hist) . . (0) . . m HMM PD00142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:49, 28 October 2015 (diff | hist) . . (+25) . . N HMM PD0142 (Mark moved page HMM PD0142 to HMM PD00142) (current)
- 17:48, 28 October 2015 (diff | hist) . . (+483) . . Phosphatase Family Myotubularin
- 22:15, 26 October 2015 (diff | hist) . . (-2,611) . . HMM PD00142
- 22:13, 26 October 2015 (diff | hist) . . (+122) . . HMM PD00142 (→Obtain phosphatase domain)
- 22:57, 21 October 2015 (diff | hist) . . (+11) . . Phosphatase Family PTP (→Non-receptor PTPs)
- 18:41, 20 October 2015 (diff | hist) . . (+123) . . HMM PD00008 (→Description)
- 18:35, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00008 (→Description)
- 18:26, 20 October 2015 (diff | hist) . . (+925) . . Phosphatase Family Sac
- 18:25, 20 October 2015 (diff | hist) . . (+25) . . N HMM PD0008 (Mark moved page HMM PD0008 to HMM PD00008) (current)
- 18:25, 20 October 2015 (diff | hist) . . (0) . . m HMM PD00008 (Mark moved page HMM PD0008 to HMM PD00008)
- 18:20, 20 October 2015 (diff | hist) . . (+395) . . HMM PD00008 (→Description)
- 05:06, 20 October 2015 (diff | hist) . . (+140) . . HMM PD00142 (→How was the HMM built?)
- 05:01, 20 October 2015 (diff | hist) . . (+4) . . HMM PD00142 (→Conserved region of MTMR14)
- 05:00, 20 October 2015 (diff | hist) . . (+44) . . HMM PD00143 (→Conserved region of MTMR14) (current)
- 04:59, 20 October 2015 (diff | hist) . . (+7) . . HMM PD0003 (→How the HMM was built) (current)
- 04:58, 20 October 2015 (diff | hist) . . (+3,887) . . N HMM PD00143 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_MTM_MTMR14_CR '''Name''': MTMR14 conserved regions === Why built the HMM? === We built the profile because the boundary...")
- 04:56, 20 October 2015 (diff | hist) . . (+102) . . HMM PD0003
- 04:49, 20 October 2015 (diff | hist) . . (+1) . . HMM PD00142 (→Conserved region of MTMR14)
- 23:23, 19 October 2015 (diff | hist) . . (+88) . . HMM PD0003 (→Why built the HMM?)
- 22:10, 19 October 2015 (diff | hist) . . (+445) . . HMM PD0006 (current)
- 17:48, 19 October 2015 (diff | hist) . . (+259) . . N HMM PD00156 (Created page with "Back to '''List of HMMs''' '''Symbol''': vertebrate_PTP_PD '''Name''': Vertebrate PTP === Description === Download the alignment of 195 vertebrate PTP sequences at ...") (current)
- 17:45, 19 October 2015 (diff | hist) . . (+143) . . HMM (→HMMs for Finding Protein Phosphatase Domain with High Coverage)
- 04:21, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 04:21, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0148 (Mark moved page HMM PD0148 to HMM PD00148) (current)
- 01:37, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:37, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0139 (Mark moved page HMM PD0139 to HMM PD00139) (current)
- 01:25, 18 October 2015 (diff | hist) . . (0) . . m HMM PD00127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 01:25, 18 October 2015 (diff | hist) . . (+25) . . N HMM PD0127 (Mark moved page HMM PD0127 to HMM PD00127) (current)
- 20:08, 17 October 2015 (diff | hist) . . (0) . . m HMM PD00129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 20:08, 17 October 2015 (diff | hist) . . (+25) . . N HMM PD0129 (Mark moved page HMM PD0129 to HMM PD00129) (current)
- 21:43, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:43, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0134 (Mark moved page HMM PD0134 to HMM PD00134) (current)
- 21:14, 16 October 2015 (diff | hist) . . (+48) . . HMM PD00144 (current)
- 21:14, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00144 (Mark moved page HMM PD0144 to HMM PD00144)
- 21:14, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0144 (Mark moved page HMM PD0144 to HMM PD00144) (current)
- 18:44, 16 October 2015 (diff | hist) . . (0) . . m HMM PD00128 (Mark moved page HMM PD0128 to HMM PD00128)
- 18:44, 16 October 2015 (diff | hist) . . (+25) . . N HMM PD0128 (Mark moved page HMM PD0128 to HMM PD00128) (current)
- 21:25, 15 October 2015 (diff | hist) . . (-34) . . Phosphatase Subfamily FCP1 (→Domain Structure)
- 21:23, 15 October 2015 (diff | hist) . . (+249) . . Phosphatase Subfamily FCP1 Tech Notes (→Use Dicty FCP1 CTD) (current)
- 21:21, 15 October 2015 (diff | hist) . . (+393) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:17, 15 October 2015 (diff | hist) . . (+297) . . Phosphatase Subfamily FCP1 Tech Notes
- 21:06, 15 October 2015 (diff | hist) . . (+105) . . N Phosphatase GeneID DdisP062 (Created page with "BRCT domain is at the C-terminal, so there must be no FCP1 CTD domain which is present in most eumetazoa.") (current)
- 21:00, 15 October 2015 (diff | hist) . . (+47) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (-29) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:59, 15 October 2015 (diff | hist) . . (+110) . . Phosphatase Subfamily FCP1 Tech Notes (→Use fruit fly FCP1 CTD)
- 20:58, 15 October 2015 (diff | hist) . . (+50) . . HMM (→HMMs of accessory domains)
- 20:51, 15 October 2015 (diff | hist) . . (+2) . . Phosphatase Subfamily FCP1 Tech Notes (→Use C. elegans FCP1 CTD)
- 20:46, 15 October 2015 (diff | hist) . . (+1,251) . . Phosphatase Subfamily FCP1 Tech Notes
- 20:42, 15 October 2015 (diff | hist) . . (+108) . . HMM (→HMMs of accessory domains)
- 20:40, 15 October 2015 (diff | hist) . . (+100) . . N HMM PD00155 (Created page with "See FCP1 technical notes about finding FCP1 CTD.") (current)
- 20:40, 15 October 2015 (diff | hist) . . (+424) . . HMM (→HMMs of accessory domains)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+8) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 19:01, 15 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:58, 15 October 2015 (diff | hist) . . (+212) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 18:43, 15 October 2015 (diff | hist) . . (+1,338) . . Phosphatase Subfamily FCP1 Tech Notes (→PSI-BLAST)
- 17:38, 15 October 2015 (diff | hist) . . (+1,075) . . Phosphatase Subfamily FCP1 Tech Notes
- 07:06, 15 October 2015 (diff | hist) . . (-36) . . Phosphatase Subfamily Tensin (→Domain Structure)
- 21:20, 14 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs of accessory domains)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0004 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0005 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0006 (Created page with "This is a stub page.")
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0007 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0009 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0010 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0021 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0011 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0012 (Created page with "This is a stub page.") (current)
- 21:19, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0013 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0014 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0015 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0018 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0019 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0001 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0016 (Created page with "This is a stub page.") (current)
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0017 (Created page with "This is a stub page.")
- 21:18, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0020 (Created page with "This is a stub page.") (current)
- 21:17, 14 October 2015 (diff | hist) . . (+20) . . N HMM PD0002 (Created page with "This is a stub page.") (current)
- 20:47, 14 October 2015 (diff | hist) . . (+16) . . Phosphatase Subfamily PTPRN Tech Note
- 19:00, 14 October 2015 (diff | hist) . . (+712) . . Phosphatase Subfamily PTPRN Tech Note
- 18:50, 14 October 2015 (diff | hist) . . (-1) . . HMM (→HMMs of accessory domains)
- 18:49, 14 October 2015 (diff | hist) . . (+823) . . N HMM PD00154 (Created page with "Back to '''List of HMMs''' '''Symbol''': VSP_VSD '''Name''': VSP, voltage sensor domain === Why built the HMM? === Voltage sensing domain is a transmembrane domain ...") (current)
- 18:37, 14 October 2015 (diff | hist) . . (+201) . . N HMM CA00001 (Created page with "PH domain is very diverse in sequence. To find PH domain, we searched PH domain against Pfam, SMART and CDD profiles. We also built in-house HMMs to find PH domains that were ...") (current)
- 18:23, 14 October 2015 (diff | hist) . . (+953) . . N Phosphatase Subfamily PTPRN Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 18:15, 14 October 2015 (diff | hist) . . (+139) . . Phosphatase Subfamily PTPRG Tech Note (→The gain of N-terminal Carbonic anhydrase (CA) domain) (current)
- 18:10, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRN
- 18:08, 14 October 2015 (diff | hist) . . (+66) . . Phosphatase Subfamily PTPRN (→Domain Structure)
- 18:02, 14 October 2015 (diff | hist) . . (+64) . . Phosphatase Subfamily PTPRG
- 17:58, 14 October 2015 (diff | hist) . . (+571) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily PTPRG Tech Note
- 17:43, 14 October 2015 (diff | hist) . . (+286) . . N Phosphatase Subfamily PTPRG Tech Note (Created page with "Phosphatase Classification: Fold CC1:Superfamily CC1: Phosphatase_Family_PTP|Family P...")
- 17:42, 14 October 2015 (diff | hist) . . (+67) . . Phosphatase Subfamily PTPRG
- 15:07, 13 October 2015 (diff | hist) . . (+289) . . Phosphatase Subfamily FCP1 Tech Notes
- 15:06, 13 October 2015 (diff | hist) . . (+665) . . N Phosphatase Subfamily FCP1 Tech Notes (Created page with "==== FCP1_C domain ==== In order to find FCP1_C domain phylogenetic distribution among FCP1, we obtained the FCP1 from our [http://resdev.gene.com/gOrtholog/view/cluster/MC000...")
- 15:06, 13 October 2015 (diff | hist) . . (-624) . . Phosphatase Subfamily FCP1 (→Technical notes)
- 07:34, 12 October 2015 (diff | hist) . . (+11) . . HMM (→HMMs for Determining the Boundaries of Protein Phosphatase Domain)
- 05:36, 11 October 2015 (diff | hist) . . (+56) . . HMM (→HMMs of accessory domains)
- 20:45, 10 October 2015 (diff | hist) . . (+16) . . HMM (→HMMs of accessory domains)
- 20:40, 10 October 2015 (diff | hist) . . (+417) . . N HMM PD00152 (Created page with "Back to '''List of HMMs''' '''Symbol''': MTMR9_GRAM '''Name''': MTMR9, GRAM domain === Why built the HMM === Other profiles of PH domain can not detect all the PH/G...") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00137 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00136 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+29) . . N HMM PD00135 (Created page with "See MTMR_GRAM.") (current)
- 20:38, 10 October 2015 (diff | hist) . . (+311) . . HMM (→HMMs of accessory domains)
- 20:18, 10 October 2015 (diff | hist) . . (+1) . . Accesory Domain Gains and Losses (current)
- 20:18, 10 October 2015 (diff | hist) . . (+42) . . Accesory Domain Gains and Losses
- 18:46, 10 October 2015 (diff | hist) . . (+346) . . N HMM PD00151 (Created page with "Back to '''List of HMMs''' '''Symbol''': DnaJ_1 '''Name''': DnaJ domain built from SMART database alignment === Description === All the DnaJ domains of auxilins are...") (current)
- 18:43, 10 October 2015 (diff | hist) . . (+68) . . HMM (→HMMs of accessory domains)
- 02:37, 10 October 2015 (diff | hist) . . (+584) . . N Phosphatase GeneID NvecP030 (Created page with "The gene model built from JGI assembly lacks C1 domain. However, we updated the sequence based upon StellaBase assembly and transcriptome data. The resulting sequence has C1 d...") (current)
- 21:35, 9 October 2015 (diff | hist) . . (-2) . . HMM (→HMMs of accessory domains)
- 21:35, 9 October 2015 (diff | hist) . . (+595) . . HMM (→HMMs of accessory domains)
- 21:29, 9 October 2015 (diff | hist) . . (+113) . . HMM PD0003
- 19:56, 9 October 2015 (diff | hist) . . (+4) . . HMM PD0149 (→How the HMM was built) (current)
- 19:56, 9 October 2015 (diff | hist) . . (+4) . . HMM PD0149 (→Why built the HMM)
- 19:55, 9 October 2015 (diff | hist) . . (+8) . . HMM PD0149
- 19:55, 9 October 2015 (diff | hist) . . (+809) . . N HMM PD0149 (Created page with "Back to '''List of HMMs''' '''Symbol''': PH_1 '''Name''': PH domain === Why built the HMM === Because our in-house HMM MTMR_GRAM can not detect all PH do...")
- 19:49, 9 October 2015 (diff | hist) . . (+74) . . HMM (→HMMs of accessory domains)
- 19:00, 9 October 2015 (diff | hist) . . (+1,682) . . N HMM PD00148 (Created page with "Back to '''List of HMMs''' '''Symbol''': SSH_NTD '''Name''': Slingshot, N-terminal domain === Why built the HMM === The Phosphatase_Subfamily_Slingshot|Slingshot ...")
- 18:50, 9 October 2015 (diff | hist) . . (+104) . . HMM (→HMMs of accessory domains)
- 18:47, 9 October 2015 (diff | hist) . . (+371) . . N Phosphatase GeneID MbreP020 (Created page with "The sequence is supposed to have SSH, N-terminal domain, which is ~210 aa long right upstream of DEK_C domain. However, the corresponding region has no similari...") (current)
- 17:53, 9 October 2015 (diff | hist) . . (0) . . HMM PD0145 (current)
- 17:53, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs of accessory domains)
- 17:28, 9 October 2015 (diff | hist) . . (+193) . . Phosphatase GeneID DdisP008
- 17:24, 9 October 2015 (diff | hist) . . (+151) . . Phosphatase GeneID DdisP009
- 05:52, 9 October 2015 (diff | hist) . . (+168) . . N HMM PD0147 (Created page with "Back to '''List of HMMs''' '''Symbol''': WW '''Name''': WW === Description === We built HMM for WW domain. === How the HMM was built === Not validated, yet.") (current)
- 05:50, 9 October 2015 (diff | hist) . . (+1) . . HMM (→HMMs of accessory domains)
- 05:50, 9 October 2015 (diff | hist) . . (+49) . . HMM (→HMMs of accessory domains)
- 05:49, 9 October 2015 (diff | hist) . . (+782) . . N HMM PD0145 (Created page with "Back to '''List of HMMs''' '''Symbol''': SAC9_NTD1 '''Name''': SAC9, N-Terminal Domain 1 === Why built the HMM? === We noticed Ddis051 ...")
- 05:18, 9 October 2015 (diff | hist) . . (+7) . . HMM PD00128
- 05:18, 9 October 2015 (diff | hist) . . (+39) . . N HMM PD0146 (Created page with "See SAC9_NTD1 (PD00145).") (current)
- 05:17, 9 October 2015 (diff | hist) . . (+135) . . HMM (→HMMs of accessory domains)
- 04:36, 9 October 2015 (diff | hist) . . (+104) . . HMM (→HMMs of accessory domains)
- 01:32, 9 October 2015 (diff | hist) . . (+947) . . N HMM PD00144 (Created page with "Back to '''List of HMMs''' '''Symbol''': IPPc '''Name''': IPPc === Description === We built HMM for IPPc domain, because the Pfam profiles [http://pfam.xfam.org/fam...")
- 01:24, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs of accessory domains)
- 01:24, 9 October 2015 (diff | hist) . . (+130) . . HMM (→HMMs of accessory domains)
- 01:22, 9 October 2015 (diff | hist) . . (0) . . HMM (→HMMs for Finding Protein Phosphatase Domain with high coverage)
- 21:26, 8 October 2015 (diff | hist) . . (+232) . . Accesory Domain Gains and Losses
- 20:40, 8 October 2015 (diff | hist) . . (+195) . . N Phosphatase GeneID DdisP009 (Created page with "Unusual domain combination of uncertain origin. If the common ancestor of Dictyostelium and opisthokonta has rhodanese domain, it is lost in Dictystelium; otherwise, it is gai...")
- 20:39, 8 October 2015 (diff | hist) . . (+195) . . N Phosphatase GeneID DdisP008 (Created page with "Unusual domain combination of uncertain origin. If the common ancestor of Dictyostelium and opisthokonta has rhodanese domain, it is lost in Dictystelium; otherwise, it is gai...")
- 18:14, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP779 (Created page with "No known function.") (current)
- 18:14, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP781 (Created page with "No known function.") (current)
- 18:13, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP780 (Created page with "No known function.") (current)
- 18:12, 8 October 2015 (diff | hist) . . (+8) . . N Phosphatase Gene HsapP778 (Created page with "PPP2CBP1") (current)
- 18:12, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP777 (Created page with "No known function.") (current)
- 18:11, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP775 (Created page with "No known function.") (current)
- 18:11, 8 October 2015 (diff | hist) . . (+155) . . Human Protein Phosphatase Pseudogene (→Functions) (current)
- 18:09, 8 October 2015 (diff | hist) . . (+310) . . Human Protein Phosphatase Pseudogene
- 18:07, 8 October 2015 (diff | hist) . . (+136) . . Human Protein Phosphatase Pseudogene
- 18:05, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP774 (Created page with "No known function.") (current)
- 18:05, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP773 (Created page with "No known function.") (current)
- 18:05, 8 October 2015 (diff | hist) . . (+14) . . Human Protein Phosphatase Pseudogene
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP772 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP771 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP770 (Created page with "No known function.") (current)
- 18:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP769 (Created page with "No known function.") (current)
- 18:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP768 (Created page with "No known function.") (current)
- 18:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP767 (Created page with "No known function.") (current)
- 18:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP766 (Created page with "No known function.") (current)
- 18:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP765 (Created page with "No known function.") (current)
- 18:01, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP760 (Created page with "No known function.") (current)
- 18:01, 8 October 2015 (diff | hist) . . (+352) . . Human Protein Phosphatase Pseudogene
- 17:49, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP764 (Created page with "No known function.") (current)
- 17:49, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP763 (Created page with "No known function.") (current)
- 17:49, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP762 (Created page with "No known function.") (current)
- 17:48, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP761 (Created page with "No known function.") (current)
- 17:46, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP759 (Created page with "No known function.") (current)
- 17:46, 8 October 2015 (diff | hist) . . (0) . . Human Protein Phosphatase Pseudogene
- 17:45, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP758 (Created page with "No known function.") (current)
- 17:45, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP757 (Created page with "No known function.") (current)
- 17:45, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP756 (Created page with "No known function.") (current)
- 17:45, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP755 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP750 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP754 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP753 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP752 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP751 (Created page with "No known function.") (current)
- 17:44, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP749 (Created page with "No known function.") (current)
- 17:43, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP748 (Created page with "No known function.") (current)
- 17:43, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP747 (Created page with "No known function.") (current)
- 17:43, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP745 (Created page with "No known function.") (current)
- 17:43, 8 October 2015 (diff | hist) . . (-11) . . Human Protein Phosphatase Pseudogene
- 17:42, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP744 (Created page with "No known function.") (current)
- 17:42, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP743 (Created page with "No known function.") (current)
- 17:42, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP742 (Created page with "No known function.") (current)
- 17:39, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP741 (Created page with "No known function.") (current)
- 17:37, 8 October 2015 (diff | hist) . . (+55) . . N Phosphatase Gene HsapP740 (Created page with "No known function. It locates in the intron of AGPAT5.") (current)
- 17:35, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP738 (Created page with "No known function.") (current)
- 17:35, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP737 (Created page with "No known function.") (current)
- 17:34, 8 October 2015 (diff | hist) . . (+36) . . Phosphatase Gene HsapP734 (current)
- 17:33, 8 October 2015 (diff | hist) . . (-23) . . Human Protein Phosphatase Pseudogene
- 17:33, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP735 (Created page with "No known function.") (current)
- 17:32, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP734 (Created page with "No known function.")
- 17:19, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP733 (Created page with "No known function.") (current)
- 17:19, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP732 (Created page with "No known function.") (current)
- 17:18, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP731 (Created page with "No known function.") (current)
- 17:18, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP730 (Created page with "No known function.") (current)
- 17:17, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP729 (Created page with "No known function.") (current)
- 17:17, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP728 (Created page with "No known function.") (current)
- 17:15, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP727 (Created page with "No known function.") (current)
- 17:15, 8 October 2015 (diff | hist) . . (+125) . . Human Protein Phosphatase Pseudogene
- 17:14, 8 October 2015 (diff | hist) . . (+485) . . N Phosphatase Gene HsapP726 (Created page with "Real-time quantitative RT-PCR results showed that expression of the 402-nt ORF was upregulated in normal tissues of kidney, liver, stomach, and lung but downregulated in corre...")
- 17:11, 8 October 2015 (diff | hist) . . (+43) . . Human Protein Phosphatase Pseudogene
- 17:10, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP724 (Created page with "No known function.") (current)
- 17:09, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP723 (Created page with "No known function.") (current)
- 17:09, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP722 (Created page with "No known function.") (current)
- 17:05, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP721 (Created page with "No known function.") (current)
- 17:04, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP719 (Created page with "No known function.") (current)
- 17:04, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP718 (Created page with "No known function.") (current)
- 17:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP717 (Created page with "No known function.") (current)
- 17:03, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP716 (Created page with "No known function.") (current)
- 17:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP715 (Created page with "No known function.") (current)
- 17:02, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP714 (Created page with "No known function.") (current)
- 17:01, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP713 (Created page with "No known function.") (current)
- 17:00, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP712 (Created page with "No known function.") (current)
- 17:00, 8 October 2015 (diff | hist) . . (+11) . . Phosphatase Gene HsapP710 (current)
- 16:59, 8 October 2015 (diff | hist) . . (+19) . . Phosphatase Gene HsapP709 (current)
- 16:59, 8 October 2015 (diff | hist) . . (+42) . . N Phosphatase Gene HsapP710 (Created page with "See DUSP8P2.")
- 16:59, 8 October 2015 (diff | hist) . . (+34) . . N Phosphatase Gene HsapP709 (Created page with "See Phosphatase_Gene_HsapP707.")
- 16:58, 8 October 2015 (diff | hist) . . (-100) . . Human Protein Phosphatase Pseudogene
- 16:58, 8 October 2015 (diff | hist) . . (+112) . . N Phosphatase Gene HsapP706 (Created page with "HsapP706 is a processed pseudogene in the introns of GABRG3 gene, not included in Entrez database on 10/08/2015.") (current)
- 16:57, 8 October 2015 (diff | hist) . . (+50) . . Human Protein Phosphatase Pseudogene
- 16:56, 8 October 2015 (diff | hist) . . (+132) . . Human Protein Phosphatase Pseudogene
- 16:55, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP705 (Created page with "No known function.") (current)
- 16:54, 8 October 2015 (diff | hist) . . (+18) . . N Phosphatase Gene HsapP704 (Created page with "No known function.") (current)
- 16:53, 8 October 2015 (diff | hist) . . (-6) . . Phosphatase Gene HsapP701 (current)
- 16:52, 8 October 2015 (diff | hist) . . (+183) . . Phosphatase Gene HsapP701
- 16:49, 8 October 2015 (diff | hist) . . (+191) . . Human Protein Phosphatase Pseudogene
- 16:48, 8 October 2015 (diff | hist) . . (+223) . . N Phosphatase Gene HsapP703 (Created page with "DUSP5P1 is highly expressed in Hodgkin's lymphoma cell line L-1236 but not in normal blood cells or Epstein-Barr virus-immortalized B cells <cite>Staege14</cite>. == Referenc...") (current)
- 16:42, 8 October 2015 (diff | hist) . . (+273) . . Main Page (→Human protein phosphatase pseudogenes)
- 16:38, 8 October 2015 (diff | hist) . . (+452) . . Main Page (→Protein phosphatase evolution)
- 16:31, 8 October 2015 (diff | hist) . . (-13) . . Main Page (→Catalytically inactive phosphatases (pseudophosphatases))
- 16:30, 8 October 2015 (diff | hist) . . (+183) . . Main Page (→Catalytically inactive phosphatases (pseudophosphatases))
- 16:29, 8 October 2015 (diff | hist) . . (+315) . . Main Page (→Classification chart)
- 05:28, 8 October 2015 (diff | hist) . . (+387) . . HMM PD00142
- 05:06, 8 October 2015 (diff | hist) . . (+37) . . N HMM PD0143 (Created page with "See CC1_MTM_MTMR14_PD.") (current)
- 05:06, 8 October 2015 (diff | hist) . . (+3,500) . . N HMM PD00142 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_MTM_MTMR14_PD '''Name''': MTMR14 phosphatase domain === Description === We built the profile because the boundary of ph...")
- 04:54, 8 October 2015 (diff | hist) . . (-2,385) . . HMM PD0138 (Replaced content with "Back to '''List of HMMs''' See CC1_MTM_PD.") (current)
- 04:53, 8 October 2015 (diff | hist) . . (+273) . . HMM PD0003 (→How the HMM was built)
- 04:48, 8 October 2015 (diff | hist) . . (-254) . . HMM PD0138 (→Why built the HMM?)
- 04:39, 8 October 2015 (diff | hist) . . (+2,705) . . N HMM PD0138 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_MTM_1_PD '''Name''': Myotubularin phosphatase domain (group 1) === Why built the HMM? === We built the profile because ...")
- 04:17, 8 October 2015 (diff | hist) . . (+35) . . HMM PD0003 (→Description)
- 21:44, 7 October 2015 (diff | hist) . . (+15) . . HMM PD0003
- 21:43, 7 October 2015 (diff | hist) . . (+115) . . HMM PD0003 (→How the HMM was built)
- 21:41, 7 October 2015 (diff | hist) . . (+159) . . HMM
- 21:33, 7 October 2015 (diff | hist) . . (+43) . . HMM (→HMMs of accessory domains)
- 21:31, 7 October 2015 (diff | hist) . . (-57) . . HMM PD00008 (→How the HMM was built)
- 21:31, 7 October 2015 (diff | hist) . . (+46) . . N HMM PD00139 (Created page with "See the page of Sac_PD profile.")
- 21:30, 7 October 2015 (diff | hist) . . (+677) . . HMM PD00008 (→How the HMM was built)
- 19:24, 7 October 2015 (diff | hist) . . (-103) . . HMM PD00008
- 16:48, 7 October 2015 (diff | hist) . . (+4) . . HMM PD0003
- 16:48, 7 October 2015 (diff | hist) . . (+2,397) . . N HMM PD00008 (Created page with "Back to '''List of HMMs''' '''Symbol''': CC1_Sac_PD '''Name''': Sac phosphatase domain === Description === We built the profile because the boundary of phosphatase ...")
- 16:47, 7 October 2015 (diff | hist) . . (+21) . . Phosphatase Family Sac
- 05:26, 7 October 2015 (diff | hist) . . (+8) . . HMM (→HMMs for Determining the Boundaries of Protein Phosphatase Domain)
- 20:32, 6 October 2015 (diff | hist) . . (+52) . . N Phosphatase GeneID DdisP036 (Created page with "DdisP036 has a long insertion in phosphatase domain.") (current)
- 20:01, 6 October 2015 (diff | hist) . . (+116) . . Phosphatase Subfamily PPIP5K (→Domain)
- 19:37, 6 October 2015 (diff | hist) . . (+66) . . Phosphatase GeneID SpurP124 (current)
- 19:36, 6 October 2015 (diff | hist) . . (+1) . . Phosphatase GeneID SpurP124
- 18:28, 6 October 2015 (diff | hist) . . (+8) . . HMM PD0003 (→How the HMM was built)
- 18:27, 6 October 2015 (diff | hist) . . (+1,209) . . HMM PD0003 (→How the HMM was built)
- 18:01, 6 October 2015 (diff | hist) . . (-604) . . HMM PD0003 (→Supplementary materials)
- 18:01, 6 October 2015 (diff | hist) . . (+123) . . HMM PD0003 (→How the HMM was built)
- 17:50, 6 October 2015 (diff | hist) . . (+423) . . HMM PD0003
- 17:45, 6 October 2015 (diff | hist) . . (+12) . . Phosphatase Subfamily MTMR14
- 17:25, 6 October 2015 (diff | hist) . . (+474) . . HMM PD0003 (→Description)
- 17:08, 6 October 2015 (diff | hist) . . (+76) . . HMM PD0003 (→Supplementary materials)
- 17:06, 6 October 2015 (diff | hist) . . (+543) . . HMM PD0003
- 16:58, 6 October 2015 (diff | hist) . . (+174) . . N HMM PD0003 (Created page with "Back to '''List of HMMs''' '''Symbol''': MTM_PD '''Name''': Myotubularin phosphatase domain === Determine the boundary === The boundaries is 205-580 in human MTMR2")
- 16:54, 6 October 2015 (diff | hist) . . (-1,270) . . HMM (→HMMs for Determining the Boundaries of Protein Phosphatase Domain)
- 16:47, 6 October 2015 (diff | hist) . . (+145) . . HMM (→Guidance for HMM building)
- 16:44, 6 October 2015 (diff | hist) . . (-5) . . HMM (→HMMs of accessory domains)
- 16:44, 6 October 2015 (diff | hist) . . (-76) . . HMM (→List of HMMs of accessory domains)
- 16:43, 6 October 2015 (diff | hist) . . (+527) . . HMM (→List of HMMs of phosphatase domains)
- 07:01, 6 October 2015 (diff | hist) . . (+9) . . Phosphatase Gene SpurP107 (current)
- 07:01, 6 October 2015 (diff | hist) . . (+142) . . N Phosphatase Gene SpurP107 (Created page with "The sequence quality is very bad due the long gaps, as found by BLATing the protein sequence against genome assembly (Baylor 2.1) via UCSC GB.")
- 06:59, 6 October 2015 (diff | hist) . . (+2,357) . . N Phosphatase Gene SpurP106 (Created page with " SpurP106 has a N-terminal region found in many scaffolds. The C-terminal region of phosphatase domains are identical to SpurP107. BLAT Search Results (against Baylor 2.1 a...") (current)
- 06:52, 6 October 2015 (diff | hist) . . (+682) . . N Phosphatase Gene SpurP093 (Created page with "SpurP093 is dubious. It locates in a short contig, probably identical SpurP089. BLAT Search Results (against Baylor 2.1 assembly in UCSC GB). ACTIONS QUERY SC...") (current)
- 23:39, 5 October 2015 (diff | hist) . . (+43) . . N Phosphatase Gene SpurP158 (Created page with "See SpurP159.") (current)
- 23:39, 5 October 2015 (diff | hist) . . (-88) . . Phosphatase Gene SpurP159 (current)
- 23:38, 5 October 2015 (diff | hist) . . (+2,014) . . N Phosphatase Gene SpurP159 (Created page with " BLAT Search Results (UCSC GB, sea urchin genome assembly Baylor 2.1) ACTIONS QUERY SCORE START END QSIZE IDENTITY CHRO STRAND START END SPAN --...")
- 23:30, 5 October 2015 (diff | hist) . . (+43) . . N Phosphatase GeneID SpurP160 (Created page with "See SpurP159.") (current)
- 19:00, 5 October 2015 (diff | hist) . . (+116) . . Phosphatase GeneID SpurP113 (current)
- 18:58, 5 October 2015 (diff | hist) . . (+276) . . N Phosphatase GeneID SpurP113 (Created page with "SpurP113 and SpurP116 are encoded by the same gene on Scaffold4. browser details SpurP113 7490 6 2542 2542 99.7% Scaffold4 ++ 251231 286263 35033 bro...")
- 18:41, 5 October 2015 (diff | hist) . . (+155) . . Phosphatase GeneID SpurP054
- 18:40, 5 October 2015 (diff | hist) . . (+187) . . N Phosphatase GeneID SpurP054 (Created page with "Though SpurP054 is fragmentary, it is different from other phosphatases in protein and genomic sequence (by BLAT in UCSC genome browser, assembly Baylor 2.1). It is therefore ...")
- 17:50, 2 October 2015 (diff | hist) . . (+763) . . Pseudophosphatases (obsolete)
- 17:50, 2 October 2015 (diff | hist) . . (+20) . . Phosphatase Subfamily TAB1 (→References)
- 17:49, 2 October 2015 (diff | hist) . . (+90) . . Phosphatase Subfamily TAB1 (→Domain)
- 17:28, 2 October 2015 (diff | hist) . . (+21) . . Phosphatase Subfamily TIMM50 (→References)
- 17:27, 2 October 2015 (diff | hist) . . (+143) . . Phosphatase Subfamily TIMM50 (→Catalytic activity)
- 17:18, 2 October 2015 (diff | hist) . . (+7) . . Phosphatase Subfamily PTPRN
- 17:16, 2 October 2015 (diff | hist) . . (+470) . . Pseudophosphatases (obsolete) (→PTPRN subfamily)
- 16:44, 2 October 2015 (diff | hist) . . (+180) . . Pseudophosphatases (obsolete) (→PTPN14 subfamily)
- 16:36, 2 October 2015 (diff | hist) . . (+23) . . Pseudophosphatases (obsolete) (→References)
- 16:36, 2 October 2015 (diff | hist) . . (+199) . . Pseudophosphatases (obsolete) (→PTPN14 subfamily)
- 16:28, 2 October 2015 (diff | hist) . . (-15) . . Pseudophosphatases (obsolete) (→Tensin subfamily: TNS1 and TNS2 (2 out of 4 members))
- 16:27, 2 October 2015 (diff | hist) . . (+1) . . Pseudophosphatases (obsolete) (→Tensin subfamily: two of three tensins are inactive)
- 16:26, 2 October 2015 (diff | hist) . . (-1) . . Pseudophosphatases (obsolete) (→One of the five of DSP3 subfamily: DUSP27)
- 16:25, 2 October 2015 (diff | hist) . . (+4) . . Phosphatase Subfamily PTPN14 (→PTPN14)
- 16:22, 2 October 2015 (diff | hist) . . (+32) . . Pseudophosphatases (obsolete) (→Tensin subfamily: two of three tensins are inactive)
- 16:21, 2 October 2015 (diff | hist) . . (+110) . . Pseudophosphatases (obsolete) (→Tensin subfamily)
- 16:18, 2 October 2015 (diff | hist) . . (+21) . . Pseudophosphatases (obsolete) (→References)
- 16:18, 2 October 2015 (diff | hist) . . (+107) . . Pseudophosphatases (obsolete) (→Tensin subfamily)
- 16:16, 2 October 2015 (diff | hist) . . (+101) . . Phosphatase Subfamily Tensin
- 16:08, 2 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily Tensin (→Functions)
- 16:08, 2 October 2015 (diff | hist) . . (+2) . . Pseudophosphatases (obsolete) (→Tensin subfamily)
- 16:08, 2 October 2015 (diff | hist) . . (+21) . . Pseudophosphatases (obsolete) (→References)
- 16:08, 2 October 2015 (diff | hist) . . (+318) . . Pseudophosphatases (obsolete) (→Tension subfamily)
- 16:06, 2 October 2015 (diff | hist) . . (-41) . . Phosphatase Subfamily Tensin (→Domain Structure)
- 05:55, 2 October 2015 (diff | hist) . . (+1) . . Pseudophosphatases (obsolete) (→Second phosphatase domain of receptor PTPs)
- 05:55, 2 October 2015 (diff | hist) . . (-5) . . Pseudophosphatases (obsolete) (→Second phosphatase domain (D2) in receptor PTPs)
- 05:55, 2 October 2015 (diff | hist) . . (+146) . . Pseudophosphatases (obsolete) (→Myotubularins)
- 05:53, 2 October 2015 (diff | hist) . . (+57) . . Pseudophosphatases (obsolete) (→PTPN23 subfamily)
- 05:46, 2 October 2015 (diff | hist) . . (+1,114) . . Pseudophosphatases (obsolete)
- 05:41, 2 October 2015 (diff | hist) . . (-2) . . Phosphatase Subfamily MTMR9 (→Catalytic activity and functions)
- 05:40, 2 October 2015 (diff | hist) . . (+5) . . Phosphatase Subfamily MTMR9
- 05:37, 2 October 2015 (diff | hist) . . (+1) . . Phosphatase Subfamily MTMR5
- 05:29, 2 October 2015 (diff | hist) . . (+27) . . Pseudophosphatases (obsolete) (→References)
- 05:29, 2 October 2015 (diff | hist) . . (+203) . . Pseudophosphatases (obsolete) (→MTMR10 subfamily)
- 05:27, 2 October 2015 (diff | hist) . . (+1) . . Pseudophosphatases (obsolete) (→Auxilin subfamily)
- 05:23, 2 October 2015 (diff | hist) . . (+77) . . Pseudophosphatases (obsolete) (→PTEN-like phosphatases)
- 05:13, 2 October 2015 (diff | hist) . . (+46) . . Pseudophosphatases (obsolete) (→References)
- 05:13, 2 October 2015 (diff | hist) . . (+195) . . Pseudophosphatases (obsolete) (→STYXL1 subfamily)
- 01:05, 2 October 2015 (diff | hist) . . (+210) . . Pseudophosphatases (obsolete)
- 00:56, 2 October 2015 (diff | hist) . . (+622) . . Pseudophosphatases (obsolete) (→Human pseudophosphatases)
- 00:55, 2 October 2015 (diff | hist) . . (+103) . . Phosphatase Subfamily STYX (current)
- 00:54, 2 October 2015 (diff | hist) . . (-36) . . Phosphatase Subfamily STYX (→Function)
- 00:50, 2 October 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily DSP3
- 00:44, 2 October 2015 (diff | hist) . . (-1) . . Pseudophosphatases (obsolete) (→Auxilin subfamily)
- 00:44, 2 October 2015 (diff | hist) . . (+7) . . Pseudophosphatases (obsolete) (→PTPN23 subfamily)
- 00:43, 2 October 2015 (diff | hist) . . (+106) . . Pseudophosphatases (obsolete) (→Second phosphatase domain (D2) in receptor PTPs)
- 00:37, 2 October 2015 (diff | hist) . . (+3) . . Pseudophosphatases (obsolete) (→Auxilin subfamily)
- 00:34, 2 October 2015 (diff | hist) . . (-4) . . Pseudophosphatases (obsolete) (→PTPN23 subfamily)
- 00:34, 2 October 2015 (diff | hist) . . (-1,353) . . Pseudophosphatases (obsolete) (→Human pseudophosphatases)
- 00:32, 2 October 2015 (diff | hist) . . (+40) . . Pseudophosphatases (obsolete) (→References)
- 00:31, 2 October 2015 (diff | hist) . . (+294) . . Pseudophosphatases (obsolete) (→Auxilin subfamily)
- 00:26, 2 October 2015 (diff | hist) . . (+503) . . Pseudophosphatases (obsolete)
- 23:51, 1 October 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily PTPN14
- 23:51, 1 October 2015 (diff | hist) . . (+62) . . Phosphatase Subfamily PTPN14 (→Functions)
- 23:49, 1 October 2015 (diff | hist) . . (+2) . . Phosphatase Subfamily PTPN14 (→Functions)
- 23:33, 1 October 2015 (diff | hist) . . (+444) . . Pseudophosphatases (obsolete) (→Subfamily PTPRC)
- 21:54, 1 October 2015 (diff | hist) . . (-9) . . Phosphatase Subfamily PTPN14 (→Domain Structure)
- 21:51, 1 October 2015 (diff | hist) . . (-10) . . Phosphatase Subfamily PTPRK (→Domain Structure)
- 21:51, 1 October 2015 (diff | hist) . . (+23) . . Phosphatase Subfamily PTPRK (→Functions)
- 21:50, 1 October 2015 (diff | hist) . . (-49) . . Phosphatase Subfamily PTPRK
- 21:48, 1 October 2015 (diff | hist) . . (-7) . . Pseudophosphatases (obsolete) (→Subfamily PTPRC (CD45))
- 21:47, 1 October 2015 (diff | hist) . . (+22) . . Pseudophosphatases (obsolete) (→References)
- 21:47, 1 October 2015 (diff | hist) . . (+32) . . Pseudophosphatases (obsolete) (→Subfamily PTPRC (CD45))
- 21:46, 1 October 2015 (diff | hist) . . (+357) . . Pseudophosphatases (obsolete) (→Subfamily PTPRC (CD45))
- 21:42, 1 October 2015 (diff | hist) . . (+22) . . Phosphatase Subfamily PTPRC (→References)
- 21:42, 1 October 2015 (diff | hist) . . (+242) . . Phosphatase Subfamily PTPRC (→Domain)
- 21:24, 1 October 2015 (diff | hist) . . (-2) . . Pseudophosphatases (obsolete) (→References)
- 21:24, 1 October 2015 (diff | hist) . . (+36) . . Pseudophosphatases (obsolete) (→Myotubularin family)
- 21:23, 1 October 2015 (diff | hist) . . (0) . . Pseudophosphatases (obsolete) (→CC1 fold)
- 21:23, 1 October 2015 (diff | hist) . . (0) . . Pseudophosphatases (obsolete) (→PTP family)
- 21:22, 1 October 2015 (diff | hist) . . (+27) . . Pseudophosphatases (obsolete) (→PTP family)
- 21:21, 1 October 2015 (diff | hist) . . (+68) . . Pseudophosphatases (obsolete)
- 21:21, 1 October 2015 (diff | hist) . . (+151) . . Pseudophosphatases (obsolete)
- 18:35, 1 October 2015 (diff | hist) . . (-1) . . Phosphatase Gene HsapP707 (current)
- 18:34, 1 October 2015 (diff | hist) . . (-2) . . Phosphatase Gene HsapP776 (current)
- 18:34, 1 October 2015 (diff | hist) . . (+23) . . Phosphatase Gene HsapP776
- 18:19, 1 October 2015 (diff | hist) . . (+175) . . N Phosphatase Gene HsapP776 (Created page with "It lacks the exons 27-29. Cannot determine whether it is expressed since the genomic regions of it and its parental gene are almost identical. It may be a protein-coding gene.")
- 18:16, 1 October 2015 (diff | hist) . . (+38) . . N Phosphatase Gene HsapP746 (Created page with "It locates within one intron of GRID1.") (current)
- 18:15, 1 October 2015 (diff | hist) . . (+76) . . N Phosphatase Gene HsapP739 (Created page with "It lacks last two exons, resulting in a trucation within phosphatase domain.") (current)
- 18:15, 1 October 2015 (diff | hist) . . (+150) . . N Phosphatase Gene HsapP736 (Created page with "No parental human gene, rather is a decayed, full length ortholog of mouse Ptprv/OST-PTP, which is transcribed in a regulated manner (PMID: 15358244).") (current)
- 18:14, 1 October 2015 (diff | hist) . . (+131) . . N Phosphatase Gene HsapP725 (Created page with "Lost the start codon; transcribed; regulates cellular levels of PTEN and is selectively lost in human cancer (see PMID: 23435381).") (current)
- 18:14, 1 October 2015 (diff | hist) . . (+114) . . N Phosphatase Gene HsapP720 (Created page with "Sequence similarity suggests that PTP4A2 is the parental gene, Entrez annotation based on PTP4A1 may be incorrect.") (current)
- 18:13, 1 October 2015 (diff | hist) . . (+33) . . N Phosphatase Gene HsapP711 (Created page with "Overlaps with pseudogene GLUD1P3.") (current)
- 18:12, 1 October 2015 (diff | hist) . . (+87) . . N Phosphatase Gene HsapP702 (Created page with "The pseudogene originates from another pseudogene CDC14C.") (current)
- 18:06, 1 October 2015 (diff | hist) . . (+421) . . N Phosphatase Gene HsapP708 (Created page with "Pseudogene HsapP708 (DUSP8P2) is obsolete due to [[http://genomeref.blogspot.com/2012/05/updating-genome-correcting-assembly-of.html the correction of assembly at 10q11.22], w...") (current)
- 18:05, 1 October 2015 (diff | hist) . . (-1) . . Phosphatase Gene HsapP707
- 18:02, 1 October 2015 (diff | hist) . . (+472) . . N Phosphatase Gene HsapP707 (Created page with "Obsolete. In Entrez gene database, it was used to be assigned to gene IDs [http://www.ncbi.nlm.nih.gov/gene/1851 1851] and [http://www.ncbi.nlm.nih.gov/gene/728813 728813]. I...")
- 17:50, 1 October 2015 (diff | hist) . . (+20) . . N Phosphatase Gene HsapP701 (Created page with "This is a page stub.")
- 17:48, 1 October 2015 (diff | hist) . . (+3,271) . . N Human Protein Phosphatase Pseudogene (Created page with "* CDC14C * CDC14BL * DUSP5P1 * DUSP5P2 * Phosphatase_...")
- 17:43, 1 October 2015 (diff | hist) . . (+92) . . Main Page (→Protein Phosphatase Classification and Evolution)
- 20:32, 30 September 2015 (diff | hist) . . (+2,795) . . N Phosphatase GeneID SpurP128 (Created page with "=== SpurP128 is a fragment of true gene or redundant to SpurP128? === 1. BLAT the protein sequences of SpurP128 and SpurP129 in UCSC Genome Browser. The results showed SpurP12...") (current)
- 20:20, 30 September 2015 (diff | hist) . . (+1,159) . . N Phosphatase GeneID SpurP196 (Created page with "=== SpurP196 is a fragment of true gene or redundant to SpurP195? === 1. BLAT the protein sequences of SpurP195 and SpurP196 in UCSC Genome Browser. The results showed SpurP19...") (current)
- 19:57, 30 September 2015 (diff | hist) . . (+3) . . Phosphatase GeneID NvecP115 (current)
- 19:57, 30 September 2015 (diff | hist) . . (0) . . Phosphatase GeneID NvecP115
- 19:57, 30 September 2015 (diff | hist) . . (+2) . . Phosphatase GeneID NvecP115
- 19:56, 30 September 2015 (diff | hist) . . (+599) . . N Phosphatase GeneID AqueP171 (Created page with "Obsolete. AqueP171 and AqueP172 are two different genes in Ensemblgenomes.org, i.e. [http://metazoa.ensembl.org/Amphimedon_queenslandica/Gene/Summary?db=core;g=Aqu1.223046;...") (current)
- 19:46, 30 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID AqueP161 (Created page with "See AqueP159.") (current)
- 19:46, 30 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID AqueP160 (Created page with "See AqueP159.") (current)
- 19:45, 30 September 2015 (diff | hist) . . (+1,130) . . Phosphatase GeneID AqueP159 (current)
- 19:32, 30 September 2015 (diff | hist) . . (+1,254) . . N Phosphatase GeneID AqueP159 (Created page with "=== AqueP159, AqueP160, AqueP161: redundant? === AqueP159 is updated and one residue longer than [http://metazoa.ensembl.org/Amphimedon_queenslandica/Gene/Summary?db=core;g=Aq...")
- 18:55, 30 September 2015 (diff | hist) . . (-515) . . Phosphatase GeneID MbreP049 (current)
- 18:55, 30 September 2015 (diff | hist) . . (+78) . . Phosphatase GeneID MbreP049
- 18:52, 30 September 2015 (diff | hist) . . (+2) . . Phosphatase GeneID AqueP098 (current)
- 18:46, 30 September 2015 (diff | hist) . . (+77) . . Phosphatase GeneID MbreP049
- 18:44, 30 September 2015 (diff | hist) . . (+1,137) . . N Phosphatase GeneID MbreP049 (Created page with "Remove. It is redundant to MbreP048. Below are the result of BLATing the protein sequences against masked scaffold sequences from JGI Monosiga genome project. match mis- ...")
- 18:39, 30 September 2015 (diff | hist) . . (-1) . . Phosphatase GeneID MbreP048 (current)
- 18:04, 30 September 2015 (diff | hist) . . (+25,125) . . N Phosphatase GeneID MbreP048 (Created page with "Our gene model of MbreP048 from JGI Monosiga genome database (accession: jgi|Monbr1|22472|fgenesh2_pg.scaffold_2000679) is identical to gene [http://protists.ensembl.org/Monos...")
- 04:42, 30 September 2015 (diff | hist) . . (+372) . . Phosphatase GeneID MbreP095 (current)
- 04:22, 30 September 2015 (diff | hist) . . (+2,548) . . N Phosphatase GeneID MbreP095 (Created page with "MbreP095 and part of Mbre096 are identical in protein sequence. To find out whether they are encoded by two genes, 1. Obtain the genomic sequence. MbreP095 and Mbre096 are f...")
- 23:59, 29 September 2015 (diff | hist) . . (+184) . . N Phosphatase GeneID SpurP200 (Created page with "The gene is an EYA. Because it is at the end of scaffold Scaffold52488, it is incomplete and lack the region encoding phosphatase domain. See Phosphatase_GeneID_SpurP124|Sp...") (current)
- 23:57, 29 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID SpurP126 (Created page with "See SpurP124.") (current)
- 23:57, 29 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID SpurP125 (Created page with "See SpurP124.") (current)
- 23:56, 29 September 2015 (diff | hist) . . (+439) . . Phosphatase GeneID SpurP124
- 22:24, 29 September 2015 (diff | hist) . . (+250) . . Phosphatase GeneID SpurP124
- 21:46, 29 September 2015 (diff | hist) . . (+1,462) . . N Phosphatase GeneID SpurP124 (Created page with "SpurP124, SpurP125, SpurP126 are partially identical in protein sequence. To find out whether they are encoded by different genes: 1. BLAT the three sequences. SpurP124 is en...")
- 21:37, 29 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID SpurP038 (Created page with "See SpurP037.") (current)
- 21:29, 29 September 2015 (diff | hist) . . (+2,604) . . N Phosphatase GeneID SpurP037 (Created page with "SpurP037 (91 aa) and part of SpurP38 (549 aa) are identical in protein sequence. To find out whether they are encoded by the same gene or not: 1. BLAT the two protein sequenc...") (current)
- 21:05, 29 September 2015 (diff | hist) . . (+4) . . Phosphatase GeneID SpurP030 (current)
- 20:59, 29 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID SpurP031 (Created page with "See SpurP030.") (current)
- 20:58, 29 September 2015 (diff | hist) . . (+1,229) . . N Phosphatase GeneID SpurP030 (Created page with "SpurP030 is identical to part of SpurP030 in protein sequence. To find whether they are encoded by the same gene: 1. BLAT the two protein sequences of SpurP030 and SpurP031 ...")
- 23:32, 28 September 2015 (diff | hist) . . (0) . . Phosphatase GeneID SpurP077 (current)
- 23:21, 28 September 2015 (diff | hist) . . (+45) . . N Phosphatase GeneID SpurP077 (Created page with "See SpurP077.")
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)